KEGG   Vitreoscilla sp. C1: ADP71_28540Help
Entry
ADP71_28540       CDS       T05336                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
vit  Vitreoscilla sp. C1
Pathway
vit00010  Glycolysis / Gluconeogenesis
vit00030  Pentose phosphate pathway
vit00051  Fructose and mannose metabolism
vit00680  Methane metabolism
vit01100  Metabolic pathways
vit01110  Biosynthesis of secondary metabolites
vit01120  Microbial metabolism in diverse environments
vit01130  Biosynthesis of antibiotics
vit01200  Carbon metabolism
vit01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ADP71_28540
   00030 Pentose phosphate pathway
    ADP71_28540
   00051 Fructose and mannose metabolism
    ADP71_28540
  09102 Energy metabolism
   00680 Methane metabolism
    ADP71_28540
Enzymes [BR:vit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     ADP71_28540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AUZ06091
UniProt: A0A2L0PPQ8
Position
complement(2189823..2190887)
Genome map
AA seq 354 aa AA seqDB search
MALVSMRQLLDHAAENSYGLPAFNVNNLEQMRAIMEAADQVNAPVIVQASAGARKYAGAP
FLRHLILAAIEEFPHIPVVMHQDHGTSPAVCQRSIQLGFSSVMMDGSLGEDGKTPTSYEY
NVDVTRRVVEMAHACGVSVEGEIGCLGNLETGLAGEEDGIGAEGVLDHSQLLTSVDEAVS
FVKDTDVDALAIAIGTSHGAYKFSRKPDGDVLRIDRIKEIHERLPNTHLVMHGSSSVPQE
WLQIINQYGGEIGETYGVPVEEIVEGIKNGVRKVNIDTDLRLASTGAIRRYLAENPSEFD
PRKYFKASVDAMKQIVIDRYLAFGCEGQASKIKPISLEKMAEAYAKGQLTQIVR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcactggtgtcaatgcgccaattactcgaccacgcggccgagaacagttatggttta
cctgcttttaatgtcaataatttggaacaaatgcgcgccattatggaagcggcagaccaa
gtgaatgctcctgtgattgtgcaagccagtgcaggtgcgcgcaaatatgcaggtgcgcca
ttcttgcgtcatttgattttggcagcgattgaagagtttccacacattccagtggtcatg
caccaagaccatggtacgagtcccgctgtgtgtcaacgctcaatccaattgggttttagc
tcagtgatgatggacggttctttgggtgaagatggcaaaaccccaacgtcttatgaatac
aacgtggacgtgacgcgtcgcgtggtggaaatggcgcatgcttgtggcgtttcagtagaa
ggcgaaatcggttgcttgggcaatttggaaacaggtttggcaggtgaagaagacggtatt
ggagcggaaggcgttttggaccacagccaattgttaacgagcgtagacgaagcggtttct
tttgtcaaagacaccgatgtggatgctttggccattgctattggtaccagccacggcgca
tacaaattcagccgcaaacctgatggcgatgtattgcgcattgatcgcatcaaagaaatt
cacgaacgtttgccaaacacgcatttggtgatgcatggctcaagctctgtgccacaagaa
tggttgcaaatcatcaaccaatacggtggtgaaattggcgaaacttacggtgtgccagta
gaagaaattgttgaaggcatcaaaaatggtgtgcgcaaagtgaatatcgacaccgatttg
cgtttggcctctactggtgcgattcgccgttatttggctgaaaatccatcagagtttgac
ccacgtaaatacttcaaagcgtcagttgatgcgatgaaacaaatcgtgattgaccgttac
ttggcattcggttgcgaaggtcaagcgagcaaaatcaagccaatttctttggaaaaaatg
gctgaagcctatgccaaaggtcaattgacgcaaatcgtgcgttaa

DBGET integrated database retrieval system