KEGG   Verrucosispora maris: VAB18032_08335Help
Entry
VAB18032_08335    CDS       T01471                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
vma  Verrucosispora maris
Pathway
vma00270  Cysteine and methionine metabolism
vma00920  Sulfur metabolism
vma01100  Metabolic pathways
vma01110  Biosynthesis of secondary metabolites
vma01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vma00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    VAB18032_08335
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    VAB18032_08335
Enzymes [BR:vma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     VAB18032_08335
    2.3.1.46  homoserine O-succinyltransferase
     VAB18032_08335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Esterase Abhydrolase_6 Tannase
Motif
Other DBs
NCBI-ProteinID: AEB42785
UniProt: F4F296
Position
complement(799980..801212)
Genome map
AA seq 410 aa AA seqDB search
MAAATLSAGSVGSVETQHLDLPAPLPLDCGRELYPVRVAYETYGTLSPQRDNVILVCHAL
SGDAHAAGFAKTPPAASTRDGFGAEGRDRPADKGLGWWDGMIGPGKAFDTDRYFVVATNL
IGGCRGTTGPSSTDPATGRPYGSDFPVLTVADMVRCQRAFLDVLGIERLAAVAGGSLGGM
QALEWAVRYPDQVDAIVVIASTHALHPQGVAWNAIARESIMRDPAWQDGHYYGTGRAPEA
GMGVARMLGHITYLSAPALTDRFGRRLQFADNIRYTFRDPEFEVESYLQHQAASFVRRFD
ANTYLYLSRALTYFDLAREHGAGSLRRALAGVSARTLLIAFSSDWLYPPAASAEIEEALH
SLGKPVEFHLIEAPYGHDSFLLEEAQQTPIVRRFLAEQCAGERRRATRNP
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagcgaccctgtcggccggctcggtcggcagcgtcgagacgcagcacctggac
ctgccggccccactacccctcgattgtggacgcgagctgtacccggtccgggtggcctac
gagacgtacggcaccctctcgccgcagcgcgacaacgtcatcctcgtctgccacgcgctc
agcggcgacgcgcacgcggccggcttcgccaagaccccaccggcggccagcacgcgcgac
gggttcggggccgagggccgtgaccgcccggccgacaaaggcctcggctggtgggacggc
atgatcggccccggcaaggccttcgacaccgaccgctacttcgtcgtcgccacgaatttg
atcggcggctgccgcggcacgaccggcccctcctcgaccgacccggccaccggccgcccg
tacggctcggattttccggtcctcaccgtggccgacatggtgcgctgccagcgggctttc
ctcgacgtgctcggcatcgaacggctcgcggccgtggccggcggatcgctcggcggcatg
caggcgctggaatgggccgtccgctaccccgaccaggtcgacgccatcgtggtgatcgcc
tccacgcacgccctgcacccgcagggcgtcgcctggaacgcgatcgcccgggaatcgatc
atgcgcgaccccgcctggcaggacggccactactacggcaccggccgggcacccgaggcc
ggcatgggcgtggcccggatgctcgggcacatcacctacctgtccgcgcccgcgctgacc
gaccggttcggccggcggttgcagttcgccgacaacatccgctacaccttccgggacccg
gaattcgaggtcgagagctacctgcaacaccaggcggcgtcgttcgtccggcgtttcgac
gccaacacctacctctacctgtcccgcgcgttgacctacttcgacctcgctcgggaacac
ggcgcggggtcccttcggcgggcgctggccggtgtgtcggcccggacgctgctgatcgcc
ttcagctccgactggctctacccaccggccgcctccgccgagatcgaggaagccctgcac
tccctcggtaagccggtcgagttccacctgatcgaagcaccctacggccatgacagcttc
ctgctcgaggaagcccagcagacccccatcgtccgtcgcttcctggccgagcagtgcgcc
ggcgagcgtcggagagcaacgaggaatccgtga

DBGET integrated database retrieval system