KEGG   Verrucosispora maris: VAB18032_27046Help
Entry
VAB18032_27046    CDS       T01471                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
vma  Verrucosispora maris
Pathway
vma00010  Glycolysis / Gluconeogenesis
vma00030  Pentose phosphate pathway
vma00051  Fructose and mannose metabolism
vma00052  Galactose metabolism
vma00680  Methane metabolism
vma01100  Metabolic pathways
vma01110  Biosynthesis of secondary metabolites
vma01120  Microbial metabolism in diverse environments
vma01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VAB18032_27046
   00030 Pentose phosphate pathway
    VAB18032_27046
   00051 Fructose and mannose metabolism
    VAB18032_27046
   00052 Galactose metabolism
    VAB18032_27046
  Energy metabolism
   00680 Methane metabolism
    VAB18032_27046
Enzymes [BR:vma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VAB18032_27046
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     VAB18032_27046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DUF128
Motif
Other DBs
NCBI-ProteinID: AEB46482
UniProt: F4F1Q7
Position
complement(5009852..5010880)
Genome map
AA seq 342 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRKGVASYGHEFVGFRDGWKGPLEGLSRPLGIAEVRGI
LPRGGTILGSSRTNPFKIENGVERIKENLAAQGVDALIAIGGEDTLGVATKLHELGVHVI
GVPKTIDNDLGATDYTFGFDTAVNIAMEAIDRLHTTAESHHRTLVVEVMGRHAGWIALHA
GLAGGANVILLPERAFDVEQVAGYVEKRFQHQYAPIVVVAEGAQPLEGQMVLQNQELDAF
GHVRLGGIGQWLAEQLEAKTGKEARTVVLGHIQRGGTPTAFDRVLATRLGLQAIDAAHEG
DWGKMVAMQSTDIVRVPLADATRELKTVPLERYAEAEVFFGS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcggcgtgctcaccggcggcggcgactgccccggtctcaacgcggtcatccgg
gcggtggtccgtaagggcgtcgccagctacggccatgagttcgtgggtttccgggacggt
tggaagggcccgctggagggtctgtcccgcccgctgggcatcgcggaggtccgggggatc
ctgccgcgcggcggcaccatcctcggctcctcgcggaccaaccccttcaagatcgagaac
ggcgtcgagcggatcaaggagaacctggccgcccagggcgtcgacgcgttgatcgccatc
ggcggtgaggacaccctcggtgtcgccaccaagctgcacgagctgggcgtccacgtcatc
ggcgtgccgaagaccatcgacaacgacctcggcgccaccgactacaccttcggcttcgac
accgcggtcaacatcgcgatggaggccatcgaccggctgcacaccaccgccgagagccac
caccgcaccctggtggtcgaggtgatgggccggcacgccggctggatcgccctgcacgcc
ggcctggccggcggcgcgaacgtgatcctgctgccggagcgggccttcgacgtcgagcag
gtggccggctacgtcgagaagcgcttccagcaccagtacgcgccgatcgtcgtggtcgcc
gagggcgcccagccgctggagggccagatggtcctgcagaaccaggaactggacgcgttc
ggccacgtccggctcggtggcatcggccagtggctggccgagcagctggaggccaagacc
ggcaaggaggcccgtaccgtcgtgctcgggcacatccagcgcggcggtaccccgaccgcg
ttcgaccgggtgctggccacccggctcggcctgcaggccatcgacgccgcgcacgagggc
gactggggcaagatggtcgcgatgcagagcaccgacatcgtccgcgtcccgctcgccgac
gccacccgggagctcaagaccgtcccgctggagcgctacgccgaggccgaggtcttcttc
ggcagctga

DBGET integrated database retrieval system