KEGG   Vibrio mimicus: AL543_02270Help
Entry
AL543_02270       CDS       T04381                                 

Definition
(GenBank) L-2-hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
vmi  Vibrio mimicus
Pathway
vmi00310  Lysine degradation
vmi01100  Metabolic pathways
vmi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vmi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    AL543_02270
Enzymes [BR:vmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     AL543_02270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo Pyr_redox_2 NAD_binding_8 FAD_binding_3 FAD_binding_2 Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AMG01879
UniProt: A0A5B6XCP8
Position
1:524153..525364
Genome map
AA seq 403 aa AA seqDB search
MIYDYVIVGGGIVGVSTAWQLKQRYPEKSILLVEKEAGFSRHQTGHNSGVIHAGVYYAPG
SLKADFCKRGVERTLAFCKQHDIPVENCGKLLVATNKQELERMHALYDRCLQNQIDVEKL
DAVQLKLAEPNIRGLGAILVKATSIVNYRLVTEKMAEAFMQLGGEVKIGTEVVGLEETPS
SVTLTCQQKNQRVSYQTRFLVTCSGLMADRLTKMLGLPTDFQIIPYRGEYYRLAPKHNQV
VRHLIYPIPDPELPFLGVHLTRMIDGSVTVGPNAVQGFKREGYGKWNFSLRDVWEMVRFP
GFWKVSAKHFKTGMVEMKNSWWKAGYLQLVRKYCPSIELPDLEPYPAGIRAQAVLSDGTL
VHDFLFAESPRSLHVCNAPSPAATSAMPIGKYLCDKIAEKSPS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatttatgattacgtgattgtcggaggcggtattgtcggcgtctccacggcttggcag
cttaaacagcgttatccagaaaaatcgattctgctggtggaaaaagaggcgggattctcc
cgccatcaaactggtcacaacagcggggtgatccatgcgggggtctattatgctcccggt
agtttgaaggccgatttttgtaagcgcggagtcgaacgcaccttggcgttttgcaagcaa
cacgatattccagtggaaaactgcggcaagttattggtggcaacgaataagcaagaactc
gaacgcatgcacgctctctatgatcgctgcttacaaaatcagatcgacgttgaaaagctt
gatgccgtgcagttgaagctggcggagcccaatattcgtggcttgggggcgatcttggtg
aaagcgaccagtatcgtcaattatcgtctggtgactgagaaaatggccgaagcctttatg
cagttgggtggcgaagtgaaaattggcactgaagtggtggggcttgaggaaacgccatcc
tcagtcacgctgacttgccaacagaagaatcaacgcgtgagttatcagacacgatttcta
gtgacctgctcaggcttaatggcggatcgcttaaccaaaatgctcggtctgccgacggat
tttcagatcatcccctatcgtggcgaatactaccgtttggcacccaagcataaccaagtg
gtgcgtcatcttatctatccgattccggatcctgaattgccgtttctcggcgtgcattta
acgcgcatgattgatggcagcgtgaccgttggccccaatgctgtacaaggctttaagcgt
gaaggttatggcaaatggaatttcagcttgcgcgatgtgtgggagatggttcgcttcccc
ggcttttggaaagtgagtgccaagcactttaaaaccggcatggtcgaaatgaaaaactcg
tggtggaaagcgggttacttacaattggtgcgtaaatactgcccaagtatcgaactgccg
gatctcgagccttaccccgcgggcattcgtgcgcaagcggtattaagtgatggcacgctg
gtgcacgatttcttatttgccgaaagtccgcgcagtttgcatgtgtgtaacgcgccttct
cccgctgccacttctgcgatgcccattggcaaatatctgtgtgacaaaatcgctgagaaa
tcgccaagttaa

DBGET integrated database retrieval system