KEGG   Vibrio mimicus: AL543_03205Help
Entry
AL543_03205       CDS       T04381                                 

Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
vmi  Vibrio mimicus
Pathway
vmi00260  Glycine, serine and threonine metabolism
vmi01100  Metabolic pathways
vmi01110  Biosynthesis of secondary metabolites
vmi01120  Microbial metabolism in diverse environments
vmi01130  Biosynthesis of antibiotics
vmi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vmi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AL543_03205
Enzymes [BR:vmi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AL543_03205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AMG02048
Position
1:complement(726218..727249)
Genome map
AA seq 343 aa AA seqDB search
MRIFVGEKMDFRSDTVTQPTEAMRLAMAQAPVGDDVYGDDPTVNELELWAAERHGFEAAL
FTTSGTQANLLGLLAHCERGDEYLCGQQAHNYRYEAGGAAVLGSIQPQPIENEPDGTLDF
AKLKAAIKPDDAHFARTKLLSLENTINGKVLPLNYLAEAREFVNQHGLQLHLDGARVYNA
AVALDVDVKEIAQYFDSMTVCLSKGLAAPVGSLLLGSSAFIARARRWRKMVGGGMRQAGI
LAAAGKLALTEQVVQLKIDHENARYLAQGLNELPGFSVNTEWVQTNIVFAKLDSHVDITA
IAARLRQEGIIITPGNPLRLVTHKDITRENIDTLLSKLQALLA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttgcggatatttgtaggagaaaaaatggactttcgatctgatacagtgactcaacccacc
gaagctatgcgccttgcgatggcgcaagcccctgtcggcgacgatgtctatggtgacgac
ccaaccgttaatgagttagagctatgggcagccgaacgccacggttttgaagccgcatta
tttaccacctcaggcacacaagccaacctattgggcttgctcgcgcattgtgagcgtggc
gatgaatatttgtgtggccagcaagcgcacaactatcgttatgaagctgggggcgcggcg
gtattgggttcaatccagcctcagccgattgaaaacgagccggatggcacactggatttc
gctaaactcaaagcggccatcaaacctgacgacgcgcattttgctcgcaccaaactgctt
agcttagaaaacaccattaatggcaaagtgctccctctcaactatttggcggaggcgcgt
gaattcgtcaaccaacatggattacaactgcacctcgacggcgctcgtgtttataacgcg
gcagtcgcgctggatgtggatgtcaaagagatcgcgcaatactttgattctatgaccgtt
tgcttgtctaaaggcttggcggctcctgtcggctcactgttactcggttcaagtgcattt
attgcaagagcaagacgttggcgcaaaatggtcggcggtggtatgcgtcaagctggcatt
ctagcggcggcaggtaaactagcactgacagaacaagtggttcagctcaaaatcgatcat
gaaaatgctcgttatttagctcaaggcctgaatgaattacccggattctccgtcaatacc
gagtgggtacaaaccaatattgtgtttgccaagctggacagtcatgtggatatcaccgcg
attgcagcacgtttacgtcaagaaggcattattatcactccggggaatccattgcgctta
gttacacacaaagacattacgcgtgagaatattgataccctcttgtcaaaactccaagct
ctactggcctaa

DBGET integrated database retrieval system