KEGG   Vibrio mimicus: AL543_03625Help
Entry
AL543_03625       CDS       T04381                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vmi  Vibrio mimicus
Pathway
vmi00071  Fatty acid degradation
vmi00280  Valine, leucine and isoleucine degradation
vmi00310  Lysine degradation
vmi00362  Benzoate degradation
vmi00380  Tryptophan metabolism
vmi00620  Pyruvate metabolism
vmi00630  Glyoxylate and dicarboxylate metabolism
vmi00640  Propanoate metabolism
vmi00650  Butanoate metabolism
vmi00900  Terpenoid backbone biosynthesis
vmi01100  Metabolic pathways
vmi01110  Biosynthesis of secondary metabolites
vmi01120  Microbial metabolism in diverse environments
vmi01130  Biosynthesis of antibiotics
vmi01200  Carbon metabolism
vmi01212  Fatty acid metabolism
vmi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL543_03625
   00630 Glyoxylate and dicarboxylate metabolism
    AL543_03625
   00640 Propanoate metabolism
    AL543_03625
   00650 Butanoate metabolism
    AL543_03625
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AL543_03625
   00072 Synthesis and degradation of ketone bodies
    AL543_03625
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AL543_03625
   00310 Lysine degradation
    AL543_03625
   00380 Tryptophan metabolism
    AL543_03625
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AL543_03625
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AL543_03625
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AL543_03625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vmi04147]
    AL543_03625
Enzymes [BR:vmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AL543_03625
Exosome [BR:vmi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AL543_03625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin HTH_7
Motif
Other DBs
NCBI-ProteinID: AMG02124
Position
1:820902..822107
Genome map
AA seq 401 aa AA seqDB search
MEKIYIVGAKRSAIGAFGGSLKDCAAGALAGQVIQAALESAKLKPESVDEVIVGNVVSAG
QGMGVGRQAALAAGLPQTVPAYSINMVCGSGMKSVMDAVAHIKAGDASVVVAAGVEVMSQ
IPFATPASLRDGQRMGSFEVKDLLINDGLTDVFNQYHMGVTAENIAKQFEISRQTQDEFA
LASQMKATAAIEAGHFKQEIVPIAVKKRRETVVFETDEYPKPTTTLAALQGLRAAFDPQG
TVTAGNASGINDGASAVIVASESAVQKLGLTPIAEIISYAQTGLDPKVMGLGPVSAVTQA
LSKAELSIDNIDLFELNEAFAAQALGVVYGLAEQHSVKPETILEKANVNGGAIALGHPLG
ASGNRILVSLLHELQRSHKEYGVASLCVGGGMGTAIVIKTV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatctatattgtgggcgcgaagcgttcagcgatcggtgcttttggtggttca
ttaaaagattgcgcagcaggtgcacttgcaggtcaagtgatccaagctgcactagagtct
gcgaaacttaaaccagaatctgtggatgaagtgattgttggcaatgtggtcagtgctggc
caaggtatgggggttggtagacaagctgcattggcggcgggtttgccacaaaccgtaccg
gcttacagcattaatatggtctgcggcagtggcatgaaatctgtgatggatgcggttgca
cacatcaaagcaggtgatgcctctgtggttgttgcggcaggcgttgaagttatgtcacaa
atcccatttgcaacaccggcaagtttacgtgatggacagagaatgggctcattcgaagtc
aaagatctgctcatcaacgatggcctaaccgatgtgtttaatcagtaccacatgggcgta
actgccgaaaacattgctaagcaattcgagatctctcgtcaaacacaggatgaatttgct
cttgctagccaaatgaaggcgactgccgctatcgaggcggggcactttaaacaagaaatt
gtgcctattgcggtgaaaaagcgacgtgaaacggtggtgtttgaaacagacgaataccca
aaacccacaacgactttggctgcattgcaaggtttgagagctgcttttgatccacaaggc
actgtgacggctggtaatgcttctggcattaatgatggcgcaagcgctgtgattgttgct
agtgagagtgctgtgcaaaaacttggtttaacgccaattgcagaaatcatcagttatgca
caaaccggattagatccaaaagtcatgggtttagggcctgtaagtgcagtaactcaagca
ttatcgaaggcggaattgtctattgacaatattgatctctttgaactcaacgaagccttt
gctgcacaagctcttggtgtggtgtacgggcttgccgagcaacactctgtcaaaccagaa
acgatactggaaaaagccaacgtgaatggcggtgctattgcgttagggcatccgctaggt
gcgtctggtaaccgcattctggtttctttgcttcatgaattacagcgtagccataaagaa
tatggcgtcgcttctctttgcgtcggtggtggtatgggcaccgcgatcgtgattaaaact
gtttaa

DBGET integrated database retrieval system