KEGG   Vibrio mimicus: AL543_06415Help
Entry
AL543_06415       CDS       T04381                                 

Gene name
recB
Definition
(GenBank) exodeoxyribonuclease V subunit beta
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
vmi  Vibrio mimicus
Pathway
vmi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:vmi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AL543_06415 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vmi03400]
    AL543_06415 (recB)
Enzymes [BR:vmi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AL543_06415 (recB)
DNA repair and recombination proteins [BR:vmi03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AL543_06415 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C UvrD_C_2 PDDEXK_1 DUF2075 AAA_11 AAA_12 AAA_30 AAA_25
Motif
Other DBs
NCBI-ProteinID: AMG02700
UniProt: A0A5B6XJZ5
Position
2:complement(67722..71348)
Genome map
AA seq 1208 aa AA seqDB search
MSADSNKLAVTLDTLRFPLHGARLIEASAGTGKTYTIAGLYLRLVLGHGCAETRHAHPLS
VDQILVVTFTEAATAELRDRIRRRLHDARLAFARGASEDPLLRSLLAEFTDHSLAVSLLL
NAERQMDEAAIFTIHGFCQRMLTQNAFESGSRFENEFVTDESRLKAQVVADYWRRQFYPL
PISLANEVRRLWPAPSALLAEIAGYLSGPPVKLTTPLMEGDLAALQQAQIARISEIKQHW
LAEREEIEPAVTGSDLHKNSQNALLRRLPILDDWAQSETQDLHVPSELEEFTQSGLLAKS
KKGNPPQLALFERIEAFLAEPVSLKTPLLVHAIHHCRHWLAKAKSTHHWLSFDDLLTQLS
AALDNDEQGLLGERIRTLYPVAMIDEFQDTDPLQYSIFSRLYLDYPQCGLLMIGDPKQAI
YAFRGADIFTYIKARNQVSAHYTLGTNWRSSAAMVAAVNQVFSSATHPFIYSDDIPFQPV
AASPGADERHWTLEGQVQPALTYWWPEDLDKPQSKTDYYAQMAEACAAQIQHILTASASG
AATFHRGEAIEAGDLAVLVRTGNEARMVRDALSEQGIASVYLSNRDSVFASDVAQDIERL
LLAVWQPEDERLLRAAVASNLFALTASELDALNNDENEWEQLIEEFRQYRRLWSERGVLP
MLRAVLTQRHIAERWLAESEGERWLTDYLHISELLQQATREIDSDQGLLRFLTQAMADAA
QGLGGSDEQIQRLESERRLVQIVTIHKSKGLEYPLVFLPFVMSYRESSEGKYYDVESATT
WVDLTGNEDALAKADQERLAEDLRLLYVALTRAVYGCFIGIAPLRNGNSSQEPTSAHRSA
MGFLLQDGQEGGIADLQQALLKQCENLPDVAQCPPPKRFEQAYQPPKLDERELTARELSQ
TIDRRWRVTSYSGLVMQSSHARHDPLQDIPLLEVGGFDLDSAQERDGAALESVERSIFNF
PRGARPGTFLHSLFEEVDFQQSAHSEPNTKIILELMESDQIETEWLPMLQHLVDTVLSTP
LDGKALRLQQIMAAQRLTELEFLLPIEVLDAPTLNRITQRHDPLSAHAGDLGFHSVQGML
KGFIDLVFQYQGRYYVLDWKSNHLGDDPAAYHPQRLGSAMADHRYDLQYQIYALALHRFL
RSRLAHYDYEQHFGGVFYLFLRGMDGRTDQGVFHTKPSLALLDELDGLIAGRELAQRASK
AGQMELDL
NT seq 3627 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccgattcaaataagctcgctgttacgctcgatacattgcgctttcccttgcat
ggggcgcggctgattgaagcttcggcaggtaccggaaaaacctacaccattgccggactc
tatctgcgtctggtgcttgggcatggctgcgcggaaactcgtcacgcgcatccgctaagc
gttgatcaaattctggtggtgacctttactgaagcggccactgcagagctgcgtgatcgt
attcgtcgccgcttgcacgatgcgcgcctcgcctttgcccgcggtgcgagtgaagatccg
ctgcttcgttccctgctggctgaatttaccgatcacagcttagccgtctctttgctgctc
aatgccgagcggcagatggatgaagcggccatttttactatccacggtttttgccagcgg
atgctgactcaaaatgcgtttgaatcgggcagtcgctttgaaaatgaattcgtcactgat
gaaagtcgcctcaaagcgcaagtggtggccgattattggcgcagacagttctaccccttg
cccatttctctcgcgaacgaagtgcgccgcttatggccggcgccctctgcgctgttggct
gagattgccggttatctttctgggccgccagtcaaactgaccacacctttgatggaaggg
gatttggccgcgctgcaacaagcgcagatagcgcgcatttccgagattaagcagcactgg
ttagcagagcgagaggagattgagcctgccgtaactggctctgacctgcacaaaaatagc
caaaatgcgctgctgcgccgtttaccgattctggatgattgggcgcaaagtgaaacgcaa
gatctgcacgtgccgtcagagcttgaagagttcacccaaagcgggttgcttgccaaatcg
aagaaaggcaatccgccacaattagcgctgtttgaacggatagaagcgtttcttgctgag
ccggtctcactcaaaacaccacttttggtgcatgcgattcatcactgtcgtcactggttg
gcgaaagccaaatctacccatcactggctctcgtttgatgacttgctcactcaactcagc
gctgcgttggataatgatgagcaagggctattgggcgagcggatccgcacgctttatccg
gtggcaatgatcgatgaattccaagataccgatccgctgcagtacagcatttttagtcgg
ctgtatctggactatccgcagtgtggtttgttgatgatcggcgacccgaaacaggcgatt
tacgctttccgtggcgcagatattttcacttacatcaaagcgcgcaatcaggtgagcgct
cactacaccttaggcactaactggcgctccagcgcggctatggtggcggcagttaaccaa
gtgtttagctccgcgactcatccgtttatttacagtgatgacattccctttcagcccgtg
gcggcaagccccggtgctgatgaacgccactggacactggaagggcaagtacaaccagcc
ttgacctattggtggcctgaagatcttgataaaccacaaagcaaaaccgattactacgcg
caaatggctgaggcgtgtgcggcgcaaattcagcacattttgactgcttcggcctctggc
gcggcaacctttcatcgaggcgaggcgattgaagcgggcgatctggcggtgctggtgcgt
actggtaatgaagcacgcatggtgcgtgatgcactcagtgagcaaggtatcgccagtgtt
tacctttccaaccgtgacagcgtgtttgccagcgatgtagcgcaagatattgaacgcttg
ctgctcgccgtgtggcagccagaagatgaacgcttgctccgtgcggccgtcgcctcgaat
ctgtttgcgttaaccgccagcgagttggatgcgctgaataatgatgaaaacgaatgggaa
cagttgattgaggagtttcgccaatatcgccgcttgtggagtgaacgcggcgtattgccg
atgctgcgtgcggtgttaactcagcgccacatcgccgagcgttggctggcggaaagtgaa
ggcgagcgctggctcaccgactatctgcacatcagcgaactcttgcagcaggccacgcgt
gagatcgatagcgatcagggcttactgcgttttctgactcaggcgatggcggatgctgcg
caagggctcggtggcagtgatgagcagatccagcgcctcgaatctgagcgccgtctggtg
cagattgtcaccatccacaaatcaaaagggcttgagtacccgctggtatttttgccgttt
gtgatgagttatcgcgagagcagcgaaggcaaatattacgacgttgaatcggccactact
tgggtcgatttaaccggcaatgaagacgcgttagccaaagccgatcaagaacgtttggca
gaagatttacgcttgctgtatgtggcgctcactcgcgctgtgtatggctgttttattggc
attgcgccgctgcgcaacggcaattcgagccaagagccgacctcggcgcatcgcagtgcg
atgggttttctgctgcaagatggtcaagagggcggtatcgcggatctgcagcaagctctg
ctcaaacagtgtgaaaacttgccagatgtcgcgcaatgcccgccaccgaagcgtttcgaa
caagcgtatcagccaccaaaattggacgagcgagagctgactgcgcgtgagttaagccaa
acgattgatcgccgctggcgagtcaccagttactcaggcttggtgatgcaatcgagtcat
gctcgtcacgatcctttgcaagacatccccttgcttgaagtgggcggttttgatcttgat
agtgcgcaagagcgtgatggcgcggcactggaatctgtcgagcgctcgattttcaatttc
ccgcgtggcgcacgccccggtactttcttgcattcattgtttgaagaggtggatttccag
caatcggcgcacagtgaacccaatactaaaatcatccttgaactgatggaaagtgatcag
attgaaaccgaatggctgccgatgttgcaacacttggtcgacaccgtattgagcacgcca
ctggatggtaaagcgctgcgcttacaacaaattatggccgcccagcgcctgaccgagttg
gagtttttactgccgatcgaagtgttggatgcgccaaccctgaatcgcatcacccagcgt
cacgatccgctctcggcacacgcgggtgatctcggttttcactcggtacaaggcatgctc
aaaggctttatcgatctggtgtttcaatatcaggggcgctattacgtgctggactggaaa
tccaaccatttgggtgacgatcctgcagcgtatcatccacagcgtttgggcagtgcgatg
gccgatcaccgttacgatctgcaataccagatttacgcgttagcgctgcatcgctttttg
cgcagccgtttagcccattacgactatgaacaacatttcggcggcgtgttttatctcttc
ttacgcgggatggatggccgcaccgatcaaggcgtattccataccaagccaagcttggcc
ttgttagatgagttggatggattgattgcagggcgcgagctggcacaaagagcgagtaaa
gctgggcagatggagcttgatttatga

DBGET integrated database retrieval system