KEGG   Vibrio mimicus: AL543_07820Help
Entry
AL543_07820       CDS       T04381                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
vmi  Vibrio mimicus
Pathway
vmi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:vmi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AL543_07820
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:vmi03011]
    AL543_07820
Ribosome [BR:vmi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AL543_07820
  Bacteria
    AL543_07820
  Archaea
    AL543_07820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AMG02958
UniProt: A0A1D8S898
Position
2:complement(371314..371646)
Genome map
AA seq 110 aa AA seqDB search
MEAIAKHNFARISPQKARLVADQIRGKSVDQALELLTFSNKKAAELVKKVLESAIANAEH
NEGADIDDLRVAKIFVDEGPVMKRIMPRAKGRADRILKRSSHITVVVADR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagctatcgctaaacataactttgctcgtatttctcctcagaaagctcgcttagtt
gcagaccaaatccgcggtaaatctgtggatcaagcgctagaacttctgactttcagcaac
aaaaaagcggctgaactggttaagaaagttctagaatctgcaatcgcgaacgcagagcac
aacgaaggtgcagacatcgacgatctacgtgtcgctaaaatcttcgtagatgagggccca
gtcatgaagcgtattatgcctcgtgctaaaggccgtgcagatcgtatcttgaagcgttca
agccacattactgtggttgtcgcagatcgctaa

DBGET integrated database retrieval system