KEGG   Vibrio mimicus: AL543_11405Help
Entry
AL543_11405       CDS       T04381                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
vmi  Vibrio mimicus
Brite
KEGG Orthology (KO) [BR:vmi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AL543_11405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 YmdB
Motif
Other DBs
NCBI-ProteinID: AMG03573
UniProt: A0A1D8SE26
Position
2:complement(1118162..1118542)
Genome map
AA seq 126 aa AA seqDB search
MDVSLPCIKIQVQTRYIEEQSDPEYHRFVFAYLITIKNLSTQTVQLLGRRWLITDADGKQ
TVVEGDGVVGEQPHIQANDEYTYSSGTALDTPVGVMQGQYLMVDEQGESFSVEIEPFRLA
VPHVLN
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggatgtttcgcttccctgcatcaaaattcaggttcaaactcgctacattgaggaacaa
tccgatcctgaatatcatcgatttgtgtttgcatacctgatcacgattaagaatctcagc
actcaaactgtgcaactattaggtcgtcgctggctgatcaccgacgccgatggtaagcag
acggtagtggaaggcgatggtgtggttggagaacagccacacattcaagctaacgatgaa
tacacctacagcagtggtacagcgctcgatacgccggtaggagtgatgcaaggtcagtac
ctgatggtcgatgaacaaggtgagtctttctcggtagaaattgaaccgtttcgcctagcg
gttcctcatgtactgaattaa

DBGET integrated database retrieval system