KEGG   Vulcanisaeta moutnovskia: VMUT_0441Help
Entry
VMUT_0441         CDS       T01440                                 

Definition
(GenBank) glucose dehydrogenase (GDH)
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
vmo00030  Pentose phosphate pathway
vmo01100  Metabolic pathways
vmo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VMUT_0441
Enzymes [BR:vmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     VMUT_0441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_zinc_N Shikimate_DH NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ADY00653
UniProt: F0QUB3
Position
427101..428156
Genome map
AA seq 351 aa AA seqDB search
MKAVTVIPLVKDSLALRDMPKPSPKRYQVLLSPIEVGVCGTDKDIIEGRYGAPPPGEEYL
ILGHESVAEVVELGDDVDNVSVGDIVVPTVRRPTTCTLPITEVDYCPRGTYAEHGIWYLH
GFATEFAVTDSQYLVKVPKEAIDVAVLTEPLSIVEKGIDLALRLGKARFESWSPRRVLIM
GAGPIGMLALMVMRLRDFADITVTATRPYDSLKAKLVREIGATYVNTNIDQINGDFDIVI
EATGSTSAAYDALRHLGADGVAVLLGIYLDSKNVNIRPLLDDWRRNKLIIGATNASIGAF
EMGVADLVKAKFEFGGWVRKLITKEVTLDEYEYAYNWGHEDIKSVIQIRSL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgttacggtaattccattggttaaggattcattggcattaagggatatgcct
aagccatcaccaaagcgataccaagtcctattgagcccaattgaggtaggtgtttgtggt
actgataaggatatcattgagggaaggtacggtgcgccaccaccgggtgaggagtacctt
atccttggtcatgagtctgtggctgaggttgttgagcttggtgacgatgttgataacgtg
agtgtcggtgacatagtcgtaccaacagtaaggagaccgacaacgtgcaccctaccaata
actgaggtggattactgcccaagaggtacatatgcggagcacggcatatggtacttgcac
ggattcgccactgagttcgctgtaacggattcccagtaccttgttaaggtacctaaggag
gccatcgacgttgctgtgcttacggagcccctaagcattgttgagaagggcattgacttg
gcattgaggcttggtaaagctaggttcgagtcctggagtccaaggagggttttgataatg
ggtgctgggcctattggtatgttggcattaatggttatgagacttagggatttcgctgac
ataacggtaacagctacgagaccctacgacagtctcaaggcgaagcttgttagggagata
ggcgcaacttatgttaatacgaacattgatcaaataaatggtgatttcgacatagtaatt
gaggcaacgggctcaacaagcgcggcatacgatgcactaaggcatctaggggctgatggc
gtggcagtgttactggggatatatctagatagtaagaatgttaatattaggccgttactg
gatgattggagaaggaataaattaattattggtgcgaccaatgccagtataggggctttc
gaaatgggtgttgcggacctcgttaaggctaagttcgagtttggaggttgggttaggaag
ttaataactaaggaggtaacacttgatgagtatgaatacgcatataactggggtcatgag
gatataaagtccgtgatccaaataaggagtttataa

DBGET integrated database retrieval system