KEGG   Vulcanisaeta moutnovskia: VMUT_1240Help
Entry
VMUT_1240         CDS       T01440                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K19588  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
vmo00040  Pentose and glucuronate interconversions
vmo00053  Ascorbate and aldarate metabolism
vmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VMUT_1240
   00053 Ascorbate and aldarate metabolism
    VMUT_1240
Enzymes [BR:vmo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     VMUT_1240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ADY01445
UniProt: F0QYL2
Position
1216797..1218218
Genome map
AA seq 473 aa AA seqDB search
MPKDREYYEIRNPADTRQIISKFPKLARDDVKAAISIAKDAFQKWSKTLPVERAKILYKT
AEIIESRANDLARLLTMEEGKTLNDSVFEVVRTANLLRFYAGLITRAQGKVIPSQDRNTI
ILTTREPLGVIAVITPWNFPLSLPAWKVIPAIATGNTVVWKPASITPTIALELVKVFYEA
GLPEGVLNLVTGPASEVGDELVTNKEIDAITFTGSLQTGKEINEKIGRQNRFIRIQLELG
GKNATILSKNGDADLAIELTVRSAFGLTGQACTATSRFLVPEDMHDEVLNKLVERTKKVV
VGNGLKNGVDMGPLASREQYEKVLSYIEIGKNEGAKLVYGGQPIRGDEEFDYGYFVMPTI
FDQVTSDMRIAKEEIFGPVLAVMTYRTLDEAIDIVNSTEYGLIAGIITKDISEAARFAEN
VKAGVIKVNKPTIGLEPWVPYGGVKSSGNDVYKEMGEEAIEFFTKIKATYIGY
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggatagagaatactacgaaatcagaaatcctgcagatactaggcagataata
tcaaaatttcccaaattagctagggatgatgttaaagccgcaatctcgattgctaaggat
gcatttcaaaaatggagtaagactttacctgttgaaagggctaaaatactctataagact
gcagaaattattgagtcaagggcaaatgatttggctaggttattaacaatggaggagggt
aagactcttaatgatagtgtgtttgaggttgtcagaacggcgaacttacttagattttat
gctggtttgataacgagagctcagggtaaggtaataccgtctcaagataggaacacgata
atacttaccaccagagagcctcttggtgtaattgccgtaattacaccctggaacttccca
ctatcattacctgcatggaaagtaataccagccatagccactggtaatactgtagtttgg
aagccagccagtataaccccaacaattgctcttgaactcgttaaggtattctacgaagcc
ggattaccagagggtgttttgaaccttgtaacgggtcctgccagtgaggttggtgatgag
ttagtaacaaataaggagatagatgccataacattcacaggctcactgcagactgggaag
gaaattaatgaaaagattggtaggcaaaacaggtttattaggatacaacttgagctaggt
ggtaagaatgctacgattctttcaaagaatggtgatgccgacttagccattgaattgact
gttaggtccgcctttggcttaactgggcaggcctgtacagctacatcaaggttcttggtg
cctgaggatatgcatgatgaggtattgaataagttagtagaaaggacgaagaaggttgtt
gttggtaatgggttaaagaatggcgttgacatgggtccattagcaagtagggagcagtat
gagaaggttctgagctatatagagattggtaagaatgaaggtgctaagcttgtttatggt
gggcaaccaattagaggagatgaggagtttgattatgggtattttgttatgccgacaata
tttgaccaggtaacttcggatatgagaatagctaaggaggagatatttggcccggtactg
gctgttatgacttataggacacttgatgaggcgatagatatcgttaactccacggaatat
ggattaatcgctggcataataactaaggatataagtgaggcagcaaggtttgctgaaaac
gttaaggccggtgtaataaaggtgaataagccaacaatagggttagaaccctgggtaccc
tacggcggtgtgaagagttcaggaaatgacgtatataaggagatgggtgaggaagccata
gaattctttacaaaaataaaggcaacatacataggatactaa

DBGET integrated database retrieval system