KEGG   Vibrio natriegens: PN96_01210Help
Entry
PN96_01210        CDS       T04636                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
vna  Vibrio natriegens
Pathway
vna00620  Pyruvate metabolism
vna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PN96_01210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vna02000]
    PN96_01210
Enzymes [BR:vna01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     PN96_01210
Transporters [BR:vna02000]
 Other transporters
  Primary active transporters [TC:3]
   PN96_01210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 GCV_H
Motif
Other DBs
NCBI-ProteinID: ALR14658
Position
1:236014..237801
Genome map
AA seq 595 aa AA seqDB search
MSKPLAITDVVLRDAHQSLFATRMRIDDMLPIAAELDKIGYWSLETWGGATFDSCIRFLG
EDPWERLRELKKAMPNTPMQMLLRGQNLLGYRHYADDVVEKFVERAHANGMDVFRIFDAM
NDVRNFQKAVKATVDVGAHAQGTLSYTTSPVHNADTWVDLAKRLEDLGCHSLCIKDMSGL
LKPYEAEELITRIKASCDVPLALHCHATTGLSTATAIKAVEAGIDILDTAISSMSSTYGH
TPTETVVAMLQGTERDTNLKLEEIEPIAAYFREVRKKYAKWEGQLKGVDSRILIAQVPGG
MLTNMEGQLKEQGAADRLDEVLEEIPRVREDLGFIPLVTPTSQIVGTQAVINVLTGERYK
SITKETAGLLKGEYGQAPAPINAELQAKVLEGKEPITCRPADLLEPEMEALTVELMDKAK
SEGIKLASERVDDVLTYALFPQVGLKFLKNRGNPEAFEPAPTLESAKPAPAPVAQASVGG
VETYSVRVDGQVYEVEVGPQGELTSVTPSAASAKAAAPAVPANTSAESVPAPLAGNIFKV
NVQPGAEVAEGDVLLILEAMKMETEVRAARGGIVQELNVKEGDAVTVGAPLLSLA
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaccactagctattactgatgtggtcctaagagacgcccatcaatcactgttt
gctacgcgtatgcgtatcgacgatatgctgcctatcgcggctgaactggacaagattggt
tattggtctttagagacgtggggtggggcaacgtttgattcgtgtattcgattccttgga
gaagatccgtgggagcgtttacgagagctgaaaaaagcgatgccgaacacaccaatgcaa
atgctactgcgtggtcagaaccttttaggataccgccattatgctgatgacgtagtagag
aagtttgttgagcgtgcgcatgccaatggtatggatgttttccgtatttttgatgcgatg
aatgatgtgcgaaatttccaaaaagcggttaaagcaaccgtggatgttggcgctcacgca
caaggcacgctgtcttacacaaccagcccagtacacaacgctgacacgtgggttgatctg
gcaaaacgtctggaagacctaggctgccattctttatgtattaaagacatgtcaggtcta
ctaaaaccttatgaagctgaagagttgattactcgtatcaaagcatcgtgtgatgtgcca
ctggcactgcactgtcatgcaactacgggtctatcaacggctactgcgattaaagcggta
gaagcgggtatcgacattcttgatactgcgatttcatcaatgagtagtacctacggccat
acgccaacagaaactgtggtagcgatgcttcagggtacagagcgtgacactaacctgaaa
ctggaagagattgagccgattgctgcttacttccgtgaggttcgtaagaaatacgcgaag
tgggaaggtcaattgaaaggcgtggactctcgcattttgattgctcaagtaccaggtggc
atgttaaccaacatggaaggccagcttaaagagcagggcgctgccgatcgtcttgatgaa
gtactagaagagatccctcgtgttcgtgaagatcttggtttcattccattggtaacacca
acttcgcaaattgtcggcactcaggctgttatcaacgtactgactggcgaacgctacaag
agcattaccaaggaaactgcgggtctgttgaagggcgaatatggtcaagcgcctgcgcca
atcaatgcagagctacaagctaaagttctggaaggtaaagagcctatcacttgccgcccg
gctgatttactagagccagaaatggaagcgctgacagttgagttgatggataaagcgaaa
tctgaaggcatcaaactggcgagcgaaagagttgatgacgtattaacttacgcgctattc
cctcaagttggccttaagttcctgaaaaaccgtggcaaccctgaagcgtttgaaccagct
cctaccttagaatctgctaaacctgctccggcaccagttgctcaagcatcagtaggcggc
gtagaaacatacagtgttcgtgttgacggacaagtttatgaagtagaagtaggaccgcaa
ggtgagctgacgtcggtaacaccttcagcagcgtcagcgaaagctgcggctccagcagta
ccagctaacacttccgctgagtcagttcctgctccacttgcgggcaacatctttaaagtc
aatgtacagccaggtgctgaagtggctgaaggtgacgtgctactgatcttagaagcgatg
aagatggaaacggaagttcgagctgcgcgtggtggtatcgttcaggagttaaatgtgaaa
gaaggtgatgccgtgacggtaggtgcacctcttcttagcctggcgtaa

DBGET integrated database retrieval system