KEGG   Vibrio natriegens: PN96_01490Help
Entry
PN96_01490        CDS       T04636                                 

Definition
(GenBank) beta-hexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
vna  Vibrio natriegens
Pathway
vna00511  Other glycan degradation
vna00520  Amino sugar and nucleotide sugar metabolism
vna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PN96_01490
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PN96_01490
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:vna03110]
    PN96_01490
Enzymes [BR:vna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PN96_01490
Chaperones and folding catalysts [BR:vna03110]
 Intramolecular chaperones
  Others
   PN96_01490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2
Motif
Other DBs
NCBI-ProteinID: ALR14710
Position
1:complement(304669..306588)
Genome map
AA seq 639 aa AA seqDB search
MEYRVDLVVLSELKQNCRFGLTFHNLSDQDLHDWHLTFAFDRFILPDSVSNGVLNQIGSF
CTLKPESMVLAANHNFYCEFSIGSNPFRYHSDGLNEALVDFVVNGNTQRAEVDVTPIVLA
SPYRERSDIPPSLIHAQPLLPKPNHIEVHESYFSLHNRVGISTYSDLANSAKDWLLDELK
RIHQFELTASNNSQVIFKSNPTLDKGAYRLKVTEESIKIEAGSKSGFTYASATLLQLIRR
NGEDTSMEVVCCSIKDRPRFKYRGMMLDCARHFHSVEQVKRLINQLAHYKFNTFHWHLTD
DEGWRIEIKSLPELTNIGAWRGLDESIEPQYTHLSQRYGGFYTQEEIKEVVAYAAQRSIT
VIPEIDVPGHCRAAIKSLPHMLVEAEDTTEYRSIQHYNDNVINPALPGSYEFIDKVLEEV
ATLFPAPYIHIGADEVPHGVWSQSPACQALMEQQGYSDYKELQGHFLRHAEDKLRGLGKR
MLGWEEAQHGNKVSKDTVIYSWLSEEAALNCARQGFDVVLQPAQTTYLDMTQDYAPEEPG
VDWANPIPLETAYSYEPLAQVADDDPVRKRIRGIQAALWCEIINNQPRMDYMIFPRLTAL
AEACWTDKQHRNWTDYLSRLKGHLPLLDLQGVNYRQPWK
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggaatatcgcgttgacctcgtcgtcctatctgagctaaagcaaaattgtcgctttgga
ctgacttttcataacttaagtgaccaagatcttcatgattggcacctgacgtttgctttt
gatcgcttcattttacctgacagcgtatctaacggtgtacttaaccaaattgggagcttc
tgtactctcaaaccagaaagtatggtactggcggctaatcacaatttctattgtgagttc
agtattggttcaaatccatttcgctatcattcagacggattgaatgaagctctggttgat
tttgtcgtcaatggtaatactcagcgagccgaggttgacgtaacacctatcgtgctggct
tcgccataccgcgagcgtagtgacattccaccgagtttgattcacgctcagcctttatta
cctaagccaaaccatattgaagttcacgagagttatttttctcttcacaaccgtgttgga
atcagtacttactccgatttagccaattcagcaaaagattggttgctcgatgaactaaaa
cgtattcaccagtttgagcttactgcgtctaataacagtcaggttatctttaaaagtaat
ccaactttagataaaggtgcgtataggctcaaagtgaccgaagaatcgataaaaatcgag
gctggttcaaagtctgggttcacctatgcaagtgcgaccctgctccaacttatcagaaga
aatggggaagatacttctatggaagtggtctgttgctcaattaaagacagacctcgtttc
aaatatcgcggaatgatgctcgattgtgcacgacacttccattccgtagagcaagtgaaa
cgtcttatcaatcaactggcacactacaagtttaataccttccactggcaccttactgac
gatgaaggctggcgaattgagattaaatccttgccagaactgacaaatattggtgcatgg
cgcgggttagatgagtccattgaaccgcaatatacgcatttgtctcagcgttatggcggg
ttttatacccaagaagaaataaaagaagtggttgcctatgcggcgcagcgcagtattacc
gtcatccctgaaattgacgtaccaggccactgccgcgctgccattaagtcactgccccac
atgcttgtagaggcagaggacaccaccgaatatcgcagtattcagcactacaacgataac
gtgattaacccagcgctaccgggcagttacgaatttatcgacaaagtgctggaagaagtt
gccactttatttcctgcaccgtatatccacattggggccgatgaagtaccacatggtgtc
tggtcgcaaagcccagcctgtcaggcgttgatggagcaacaaggctatagcgactacaaa
gaactgcaaggtcacttcttgcgtcatgcggaagacaaacttcgcgggcttggtaaacga
atgctgggatgggaagaagctcagcatggcaacaaggtcagtaaagataccgttatctac
tcatggctaagtgaagaagcggctctcaattgtgctcgccaaggtttcgatgtggtgctg
caacccgcccaaaccacctacttggatatgactcaagactacgcgccagaagaacctgga
gtggattgggcaaacccgattccactggagacagcgtacagctacgagccgttagcacaa
gtggcagacgacgatccggttagaaaacgtattcggggcattcaggctgcactttggtgc
gaaatcatcaataaccagccacgtatggactacatgatatttccccgcctgacggcatta
gcagaagcatgctggaccgataagcagcaccgcaactggactgattacctatcacgtttg
aaggggcaccttccactgctcgatctgcagggagtgaattaccgccaaccgtggaagtaa

DBGET integrated database retrieval system