KEGG   Vibrio natriegens: PN96_05065Help
Entry
PN96_05065        CDS       T04636                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
vna  Vibrio natriegens
Pathway
vna00270  Cysteine and methionine metabolism
vna00920  Sulfur metabolism
vna01100  Metabolic pathways
vna01110  Biosynthesis of secondary metabolites
vna01130  Biosynthesis of antibiotics
vna01230  Biosynthesis of amino acids
Module
vna_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:vna00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    PN96_05065
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PN96_05065
Enzymes [BR:vna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     PN96_05065
    2.3.1.46  homoserine O-succinyltransferase
     PN96_05065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: ALR15379
Position
1:complement(1085552..1086493)
Genome map
AA seq 313 aa AA seqDB search
MPIRIPDQLPATDILRTENIFVMSETRAASQEIRPLRVLILNLMPKKIETETQFLRLLSN
SPLQVNVELLRIDDRPSKNTPTEHLDNFYRQFEMVKNKNFDGLIITGAPLGLVQFEDVLY
WDHLKTIMEWAKDHVTSTLYVCWAAQAGLKLLYDLPKKTRKEKLSGVYHHQIHNQYHPIL
RGFDDTFLAPHSRYADFSPHFLEEHTDLDILATSDVAGVYLATTKDKRNVFVTGHPEYDS
HTLHNEYIRDLGEGMEPAIPVNYYPNNNPDNVPSASWRSHGHLLFANWLNYCVYQQTPYD
LDHFSESAFTKDD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgccaattagaattccagatcaattaccagcaactgacatactaaggacagagaacatc
ttcgtgatgagtgagactcgagcggctagtcaggaaatacgtccgttgcgagtactgatt
ctgaatttgatgcctaaaaaaattgagactgaaacgcagtttttgcgtttgctttcaaac
agtcctttgcaagtcaatgtcgaattattgcggattgatgatcgcccgagtaaaaatacg
cctaccgagcatctggacaatttttatcgtcaatttgagatggttaaaaataagaacttt
gatggcttaattatcacaggcgcgccacttggcctagtacagtttgaagatgtgctttat
tgggaccatttaaaaacaatcatggagtgggctaaagatcatgtcacctctaccctttac
gtatgttgggcagctcaagctgggttaaagttactttatgacctgccgaaaaagacgcgt
aaagagaagctttcaggtgtttaccaccatcaaattcataaccagtatcatccaatatta
cgcggctttgatgatacgtttttggctccgcattctcgctatgcagacttttcacctcac
ttccttgaggaacatacggacctggatatcttagcgacttctgatgtggctggcgtttac
ctagcaacaaccaaagacaaacgaaacgtatttgtgacgggccaccctgagtatgactct
catactctccacaatgagtacattcgtgatttgggcgaaggaatggagccggcaattccg
gtgaattactacccgaacaataatccagacaatgttccgagtgcaagctggagaagccat
ggtcacttgctgttcgcaaactggctaaactactgtgtttaccaacaaacaccgtacgat
cttgaccatttcagtgagtctgctttcactaaagatgactaa

DBGET integrated database retrieval system