KEGG   Vibrio natriegens: PN96_06815Help
Entry
PN96_06815        CDS       T04636                                 

Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
vna  Vibrio natriegens
Pathway
vna00860  Porphyrin and chlorophyll metabolism
vna01100  Metabolic pathways
Module
vna_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:vna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PN96_06815
Enzymes [BR:vna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     PN96_06815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 CCDC85
Motif
Other DBs
NCBI-ProteinID: ALR15708
Position
1:complement(1485532..1486149)
Genome map
AA seq 205 aa AA seqDB search
METLNIYLMRHGKVDAAPGLHGQSDLKVKESEQQDIAQAWKEQGREVSGIITSTLSRCSD
VAEIIGEQQMLPVSENSELREMNFGDFDGVPFDMLNDNWKKLESFWQSPSQHTLPNAESL
NAFSQRVTSAWSQIINDINDNLLIVTHGGVIRMILAHILDVDWRNPRWYSTLAISNASIT
HITITIDDQIYASVRSIGVPLIEHR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgcttaatatctatctcatgcgtcacggtaaagtggatgccgcacctgggttg
cacggtcagtcggatttaaaggtaaaagagtccgagcagcaagacattgctcaggcttgg
aaagagcagggacgtgaagtcagcggtattattacgtctacactttcccgttgcagcgac
gtggcagaaatcatcggcgagcagcaaatgcttcctgtgagcgaaaattctgaactaaga
gaaatgaattttggcgatttcgatggtgtgccgtttgacatgctgaacgacaattggaaa
aaactagagtccttctggcaatctccgtcacaacacaccttacccaatgctgagagcctt
aacgcattttcacagcgtgtaactagtgcctggtctcaaattatcaatgatatcaatgac
aacctgctgattgtcacgcatggtggcgttattagaatgattctcgctcatatattagac
gttgactggcgcaacccgcgttggtattcgacgttagcgatcagtaatgcgtcaatcaca
catataacaatcactattgatgaccaaatctacgcctccgttcgttcgataggtgtacct
ttgattgagcatagatag

DBGET integrated database retrieval system