KEGG   Vibrio natriegens: PN96_09365Help
Entry
PN96_09365        CDS       T04636                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
vna  Vibrio natriegens
Pathway
vna00520  Amino sugar and nucleotide sugar metabolism
vna01100  Metabolic pathways
vna01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PN96_09365 (nagA)
Enzymes [BR:vna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     PN96_09365 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ALR16181
Position
1:2059997..2061133
Genome map
AA seq 378 aa AA seqDB search
MYALTNCKIYTGSDVLQEHAVIIENDLIQSVVPVAELPKGIEVKDLNGANLSPGFIDLQL
NGCGGVMLNDDITPKTMQIMHEANLKSGCTSYLPTLITSSDEDMRAAITAAREYHDKYQN
QSLGLHLEGPYLNVAKKGIHNVDFIRTSDEDMIDLICANSDIIAKVTLAPEQNDPEHIRR
LKAAGVVVSIGHTNATYKEARQGFEAGISFATHLFNAMTPMVGREPGVVGAIYDTPEVYA
GIIADGFHVDYANIRIAHKIKGEKLVLVTDATAPAGANIDHFIFVGKKVYYRDGKCVDEN
GTLGGSALTMIEAVQNTVEHAGIALDEALRMATLYPATAIGVEDKLGRIRTGMVANLTVF
DRDFNVKATVVNGQYEHN
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgctaactaactgtaaaatctataccggtagtgatgttctacaagaacatgcg
gtcatcatcgaaaacgacctaattcaatccgttgtaccagttgccgaactaccgaaaggc
atcgaggtgaaagatctaaatggtgcgaacctaagtccaggattcattgaccttcaacta
aacggttgtggcggcgttatgttgaatgacgacatcacaccaaaaacaatgcaaatcatg
catgaggcaaacctcaagtctggttgtactagttacttgccgacactgattacctcttca
gacgaagacatgcgtgccgcgatcacggcagctcgcgaataccacgataaataccaaaat
caatcactaggtctacacttggaaggaccgtatcttaacgtcgcgaaaaaaggcatccac
aatgtcgactttattcgcacctcagatgaagacatgattgatctgatttgtgctaatagt
gacatcatcgcgaaggtgacgcttgcaccagagcagaatgaccctgagcatattcgacgc
ttaaaagcggctggtgtggttgtttctatcggacatactaacgctacgtataaagaagct
cgtcaaggctttgaagctggtatttcctttgcgactcacctgtttaacgcgatgacaccg
atggttggacgcgaacctggagtggttggtgcaatttacgacacgccagaagtttatgct
ggaattatcgccgatggtttccacgtagactacgcaaacatcagaattgctcataaaatc
aaaggtgagaagcttgttttggtgacggatgccacagctccagcaggtgctaacattgat
cactttatttttgtcggtaagaaagtatattaccgagatggtaagtgtgttgatgaaaat
ggcacactaggcggctcagccctgactatgattgaagcagttcagaatacggttgagcac
gcaggtatcgctttagacgaagctctacgtatggccacattgtatccagcaaccgctatt
ggggttgaagataaacttggccgaattcgaacaggcatggtagcaaacctgactgttttc
gatcgtgacttcaatgtaaaagcgacggttgttaacggacaatacgagcacaattaa

DBGET integrated database retrieval system