KEGG   Vibrio natriegens: PN96_10585Help
Entry
PN96_10585        CDS       T04636                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
vna  Vibrio natriegens
Pathway
vna00620  Pyruvate metabolism
vna00630  Glyoxylate and dicarboxylate metabolism
vna01100  Metabolic pathways
vna01110  Biosynthesis of secondary metabolites
vna01120  Microbial metabolism in diverse environments
vna01200  Carbon metabolism
Module
vna_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PN96_10585
   00630 Glyoxylate and dicarboxylate metabolism
    PN96_10585
Enzymes [BR:vna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PN96_10585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI SLATT_3
Motif
Other DBs
NCBI-ProteinID: ALR16390
Position
1:complement(2309526..2311154)
Genome map
AA seq 542 aa AA seqDB search
MLAQTEQKTQPTKQTQGMLEVTGALAPEHQAIFPSEAQTFLSLLCEKYAGRVEQLLQARE
EKQARIDAGELPDFLPETQDIREGSWKILGIPQDLQDRRVEITGPTDRKMVINALNANVK
VFMADFEDSMSPAWTKVLDGQVNLRDAVNGTISYTNPGNGKHYQLADDPAVLICRVRGLH
LKEKHVTWHGQIIPGALFDFALYFYNNYKTLLQKGSGPYFYIPKLQSHHEAKWWSEVFHF
TEEYFGLETGTIKATVLIETLPAVFEMDEILFSLKEHIVGLNCGRWDYIFSYIKTLKNHP
DRVLPDRQVVTMDKPFLNAYSRLLVRTCHKRGAFAMGGMAAFIPAKDQEENQKVLDKIHN
DKSLEANNGHDGTWVAHPGLADTAMEVFSNILGERSNQLEVSRSEDAPITAAELLEPCEG
ERTEQGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHGKSLDNG
QQVTKELFESYLKEEVEVVKQEIGEERYQAGRFEEAAQLMAKLTTSDELTNFLTIPGYDY
LD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctcagacagaacaaaaaacacaaccaacgaagcagacccaaggcatgcttgag
gttactggtgcacttgctccggaacatcaggcaattttcccttcagaggcccaaaccttc
ttatcactgctttgtgaaaaatatgccggacgtgtagaacaactgctgcaagctcgagaa
gaaaaacaagcacgcatcgatgcgggtgaactgccagactttttgccagaaacacaagac
attcgcgaaggaagctggaagatcttagggattccgcaagatctgcaagatcgccgagta
gaaatcacaggtccaacggatcgtaaaatggtgattaacgctctgaatgcgaacgtaaaa
gtatttatggcagacttcgaagactcgatgtctccagcttggaccaaggtattggatggt
caggtgaacctgcgtgatgccgtaaatggcaccatcagttacaccaatcctggcaacggt
aagcattatcagctggcagacgacccagcggtgttgatctgccgtgtacgcggccttcat
ttaaaagaaaaacacgttacgtggcacggtcagatcattccaggcgcactgtttgatttc
gcgttgtacttctacaacaactacaaaacgctactacaaaaaggcagcggcccttacttc
tacattcctaagctgcaatctcaccacgaagcgaagtggtggagtgaagtgttccatttc
accgaagaatactttggtctagaaaccggaacgatcaaagcgacggtgcttatcgagaca
ctgcctgctgtgtttgaaatggatgagattctgttctcgcttaaagagcatatcgtaggt
ctgaactgtggccgctgggattacattttcagctacatcaaaacattaaagaaccaccca
gaccgcgtactacctgaccgtcaggttgtgacgatggataagccgttcctaaatgcctac
tcacgactactggtacgtacttgtcataaacgcggtgcgtttgcgatgggcggcatggca
gctttcattcctgcaaaagaccaggaagagaaccagaaggttctggataagattcataac
gataagtcattagaagcgaacaatggccacgacggaacttgggttgctcacccaggcctg
gcagatactgcaatggaagtattcagcaatatccttggcgagcgttcaaatcagctggaa
gtcagccgctctgaagacgcgcctattaccgctgctgaattgcttgagccttgtgaaggc
gagcgtacagaacagggcatgcgtcataacatccgtgttgcgcttcagtacatcgaagct
tggatttcaggcaatggttgtgtgccaatctacggcttgatggaagatgccgctaccgca
gagatttctcgcgcttcgatctggcagtggattcaacatggtaagtcgctggataacggc
caacaagttacaaaagagctgttcgaatcctacctgaaagaagaagtagaagttgtgaaa
caagaaattggagaagagcgttatcaagccggtcgctttgaggaagctgcgcaattgatg
gcgaagctgacaaccagcgatgagctaacgaacttcttaaccattccaggttatgactac
ttggactaa

DBGET integrated database retrieval system