KEGG   Vibrio natriegens: PN96_14775Help
Entry
PN96_14775        CDS       T04636                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
vna  Vibrio natriegens
Pathway
vna00670  One carbon pool by folate
vna01100  Metabolic pathways
vna01120  Microbial metabolism in diverse environments
vna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PN96_14775 (metF)
Enzymes [BR:vna01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     PN96_14775 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR DUF3830
Motif
Other DBs
NCBI-ProteinID: ALR17132
Position
1:3205651..3206547
Genome map
AA seq 298 aa AA seqDB search
MGYTHAGHIDALNQNIAELSDNINVSFEFFPPSNEKMEETLWNSVHRLKTLKPKFVSVTY
GANSGERDRTHSIIKEIKSETGLVAAPHLTCIDATREELIEIADDYWNNGIENIVALRGD
IPPGGGAPDMYASDLVELLKSRHDFDISVAAFPEVHPEAKSAQADLLNLKRKVDAGANRA
ITQFFFDVESYLRFRDRCVVAGIDVEIVPGILPVSNFKQASRFAAQNNVKVPGWMSKQFE
GLDDDPVTRQLVGASQAIDMVRVLSREGVKDFHFYTLNRAEMTYALCHTLGVRPQVAV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgggttacacgcacgcaggccatatcgatgccttaaaccagaatatcgctgaattgtca
gacaatattaatgtttcatttgagttttttccgccaagcaatgaaaagatggaagagacg
ctatggaactctgtgcaccgtctaaaaacactcaagcctaagtttgtttctgttacttac
ggagctaactcaggcgagcgtgacagaactcattccatcatcaaagaaatcaaatcagaa
acaggcttagtggcagcaccgcacctgacttgtatcgatgcgactcgtgaagaattgatt
gagattgccgatgattactggaacaacggtatcgaaaatatcgtcgcactacgtggtgat
attccaccaggtggcggcgctcctgatatgtacgcatctgacctggttgaactgttgaag
tctcgtcatgatttcgatatctcagttgcagctttcccagaagtgcatcctgaagcaaaa
agcgcacaggctgatctgctaaacctgaagcgtaaggtcgatgcaggtgcgaaccgagcg
attactcagtttttcttcgatgtagagtcttacctacgttttcgtgaccgctgtgttgtc
gctggtatcgacgtagaaatcgtaccgggtatcttgccagtatctaactttaaacaggcg
tctcgctttgctgcgcagaataacgtaaaagttccaggctggatgagcaagcagtttgaa
ggtttggatgatgatccggtaactcgtcaattagttggtgcaagtcaggcgattgatatg
gtgcgtgtactgagccgtgaaggtgtgaaagacttccacttttacactctaaaccgagct
gagatgacttacgcgttgtgtcacaccttgggtgtacgtcctcaagttgcagtctaa

DBGET integrated database retrieval system