KEGG   Vibrio natriegens: PN96_14920Help
Entry
PN96_14920        CDS       T04636                                 

Gene name
pgi
Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
vna  Vibrio natriegens
Pathway
vna00010  Glycolysis / Gluconeogenesis
vna00030  Pentose phosphate pathway
vna00500  Starch and sucrose metabolism
vna00520  Amino sugar and nucleotide sugar metabolism
vna01100  Metabolic pathways
vna01110  Biosynthesis of secondary metabolites
vna01120  Microbial metabolism in diverse environments
vna01200  Carbon metabolism
Module
vna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
vna_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:vna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PN96_14920 (pgi)
   00030 Pentose phosphate pathway
    PN96_14920 (pgi)
   00500 Starch and sucrose metabolism
    PN96_14920 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    PN96_14920 (pgi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vna04147]
    PN96_14920 (pgi)
Enzymes [BR:vna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     PN96_14920 (pgi)
Exosome [BR:vna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PN96_14920 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   PN96_14920 (pgi)
  Exosomal proteins of colorectal cancer cells
   PN96_14920 (pgi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-ProteinID: ALR17160
Position
1:3237428..3239080
Genome map
AA seq 550 aa AA seqDB search
MLKNINPTQTQAWKALTAHFESAQDMDLKELFAQDADRFDKYSARFGSDILVDYSKNLIN
EETLKHLFTLAKETELKSAIEAMFSGEAINQTEGRAVLHTALRNRANTPVMVDGEDVMPA
VNAVLEKIKSFTERVIGGEWKGYTGKAITDIVNIGIGGSDLGPYMVTEALAPYKNHLNLH
FVSNVDGTHIVETLKKVDPETTLFLIASKTFTTQETMTNAHSARDWFLETAGDQAHVAKH
FAALSTNATAVSEFGIDTDNMFEFWDWVGGRYSLWSAIGLSIALAVGFDNFVELLDGAHE
MDKHFVSTELESNIPVILALIGIWYNNFHGAESEAILPYDQYMHRFAAYFQQGNMESNGK
YVDRDGNAVTYQTGPIIWGEPGTNGQHAFYQLIHQGTKLIPCDFIAPAISHNPASDHHQK
LMSNFFAQTEALAFGKCVETVKEELVLSGKNAEEVAAIAPFKVFEGNRPTNSILVKQITP
RTLGNLIAMYEHKIFVQGVIWNIFSFDQWGVELGKQLANQILPELADESAISSHDSSTNG
LINAFKAFKA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaatatcaatccaacgcaaacacaagcttggaaagcgttaacagcgcacttc
gaatctgcacaagatatggatctaaaagagctgtttgctcaagacgcggatcgttttgac
aaatactctgcacgtttcggctcagacattcttgtcgactactcaaagaacctcatcaat
gaggaaactctgaagcacctgttcactcttgctaaagagactgagctgaaatctgcaatc
gaagcgatgttcagtggtgaagcgatcaaccagacagaaggccgtgcagttctgcacacc
gctctgcgtaaccgtgcgaatacaccggttatggttgatggtgaagacgtaatgccagct
gtaaatgccgttctggaaaaaattaagtctttcacagagcgtgtgattggcggtgaatgg
aaaggttacactggtaaagcgattacagatatcgtaaacatcggtatcggtggttctgac
cttggtccttacatggtgacggaagcactggcaccatacaaaaaccatctaaacctgcat
ttcgtgtctaacgttgatggcactcacatcgtagagacactaaagaaagtcgatcctgaa
acaacactattcctgatcgcttctaaaacattcacaactcaagaaaccatgactaacgcg
cattctgctcgtgattggttcctggaaacggctggcgatcaagcacacgttgctaagcac
ttcgcggcactttctactaacgcgacagcagtttctgagttcggtatcgacacagacaac
atgtttgaattctgggactgggttggcggtcgttactctctatggtctgcaatcggtctt
tcaattgcactagccgttggcttcgacaacttcgttgagctacttgatggcgcacacgag
atggacaagcactttgtctcaacagaactggaaagcaacatcccagtgatcctggcgctt
atcggcatttggtacaacaacttccacggcgcagagtctgaagctatcctgccttacgat
cagtacatgcaccgtttcgcagcgtacttccagcaaggtaacatggagtcaaacggtaaa
tacgttgaccgtgacggtaatgctgtgacttaccaaactggcccaatcatctggggtgaa
ccaggtacaaacggccagcacgcgttctaccagctaatccaccaaggtactaagctgatc
ccatgtgacttcattgcacctgcaatcagccacaacccagcaagcgatcaccatcagaaa
ctgatgtcgaacttcttcgcacaaacagaagcgcttgcgtttggtaagtgtgtagagaca
gtgaaagaagagttggtactatctggtaaaaatgcagaagaagtagcggctatcgctcca
ttcaaagtatttgaaggtaaccgcccaactaactctatcttagttaagcaaatcacacct
cgcacgctaggtaacctaatcgcaatgtacgagcacaagatcttcgtacaaggcgttatt
tggaacatcttcagctttgaccaatggggtgttgagctaggtaaacaactagcaaaccaa
atcctgccagagctagctgatgaatcggcaatcagttcacacgatagctctacaaatggt
ctgatcaacgcattcaaagctttcaaagcgtaa

DBGET integrated database retrieval system