KEGG   Vibrio natriegens: PN96_17215Help
Entry
PN96_17215        CDS       T04636                                 

Gene name
groEL
Definition
(GenBank) molecular chaperone GroEL
  KO
K04077  chaperonin GroEL
Organism
vna  Vibrio natriegens
Pathway
vna03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:vna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    PN96_17215 (groEL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vna03019]
    PN96_17215 (groEL)
   03110 Chaperones and folding catalysts [BR:vna03110]
    PN96_17215 (groEL)
   03029 Mitochondrial biogenesis [BR:vna03029]
    PN96_17215 (groEL)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vna04147]
    PN96_17215 (groEL)
Messenger RNA biogenesis [BR:vna03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     PN96_17215 (groEL)
Chaperones and folding catalysts [BR:vna03110]
 Heat shock proteins
  HSP60 / Chaperonin
   PN96_17215 (groEL)
Mitochondrial biogenesis [BR:vna03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    PN96_17215 (groEL)
Exosome [BR:vna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PN96_17215 (groEL)
  Exosomal proteins of other body fluids (saliva and urine)
   PN96_17215 (groEL)
  Exosomal proteins of breast cancer cells
   PN96_17215 (groEL)
  Exosomal proteins of colorectal cancer cells
   PN96_17215 (groEL)
  Exosomal proteins of bladder cancer cells
   PN96_17215 (groEL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn60_TCP1 REF Pho88
Motif
Other DBs
NCBI-ProteinID: ALR17710
Position
2:521422..523020
Genome map
AA seq 532 aa AA seqDB search
MAAKDVLFANDARQKMLKGVNLLADAVKVTLGPKGRNVVLDKSYGAPTITKDGVSVAKEI
ELKDKFENMGAQMVKQVASKANDEAGDGTTTATVLAQSFINEGLKAVASGMNPMDLKRGI
DKATEAAVEKLREMSKPCSDKESITQVGSISANSDRAIGEIIAEAMEKVGRNGVITVEEG
QGLDNELSVVEGMQFDRGYLSPYFITNQENGSVELDNPYILLVDKKVSSIRELLPVLEAV
AKSSRSLLIIAEDIEGEALATLVVNNMRGIVRAAAVKAPGFGDNRKAMMEDIAVLTAGTV
ISEEIGLELEKATIEQLGSAKKVTINKDTTTIVGGSAKAEAIADRVASIEKQMETTTSQY
DKDKLQQRIAKLSGGVAVIKIGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALI
KIAKELAALKGENDDQNVGIRVALRAMEEPLRQIAANAGDEASVVANAVKAGDADYGYNA
ATGEYGNMIEMGILDPAKVTRSALQFAASVAGLMISTEAMITNHVDDKELDI
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaaagatgtgttatttgctaatgacgcgcgtcaaaaaatgctgaaaggtgtg
aacttacttgcggatgcagtaaaagtgacactcggtccaaaaggtcgcaatgttgtttta
gataaatcttacggtgcgccaaccatcacgaaagatggggtgtctgttgcgaaagaaatc
gagctcaaagacaaattcgaaaatatgggcgcacaaatggtgaagcaagttgcgtccaaa
gcgaacgatgaagcgggtgacggtacaacaaccgcaacggtgttggcacaatctttcatc
aacgaaggtcttaaagcggtggcttcgggcatgaacccaatggacctaaaacgcggtatc
gacaaagccaccgaagcggcagttgagaaactacgtgaaatgtccaaaccatgcagtgac
aaagaatccattactcaagttggtagcatttctgcaaacagcgatcgtgcgatcggcgaa
atcattgcagaagcgatggaaaaagtaggtcgcaatggtgtgattaccgttgaagaaggt
caaggcctggacaacgaattgtctgtggttgaaggtatgcaattcgaccgcggttacttg
tcgccatacttcatcacaaaccaagaaaatggcagcgtagagctagataatccatacatt
cttttggtggacaaaaaagtcagcagtatccgtgagctattgccagtgctggaagcggtg
gcaaaatcttctcgatcactattgatcattgctgaagacatcgaaggcgaagcgctggcg
acactggtcgtgaacaacatgcgtggtatcgtacgcgcagcggccgtgaaagcacctggg
tttggtgacaaccgcaaagcgatgatggaagacattgcggtactaaccgcgggtaccgtt
atttctgaagaaatcggtctagagctagaaaaggcaacgatagagcaactgggtagtgcg
aagaaagttactatcaacaaagatacaaccacaatcgtaggtggtagtgccaaagccgaa
gcgattgctgatcgcgtcgcgtcgattgaaaaacaaatggaaaccacgacatctcaatat
gacaaagacaagctacagcaacgtattgcgaagctttctggtggcgtagccgtgatcaaa
atcggtgcggcaaccgaagttgagatgaaagagaagaaagatcgcgtggacgatgcgcta
catgcaactcgtgccgcggttgaagaaggtattgtcgctggtggtggtgtggccctaatt
aagatcgcgaaagaattggcggctctaaaaggtgaaaacgatgatcaaaatgttggtatc
cgtgttgcactccgtgcaatggaagaacctcttcgccaaatcgcagccaacgctggtgat
gaagcatccgtggttgcgaatgctgtaaaagcgggtgacgcagattacggttacaacgca
gctacgggtgaatacggcaacatgatcgaaatgggcatcctcgacccagcgaaagtaaca
cgttctgcgcttcaattcgcagcgtctgttgctggtttgatgatcagcacagaagcgatg
atcactaaccacgtagatgacaaagagcttgatatctaa

DBGET integrated database retrieval system