KEGG   Vibrio natriegens: PN96_18050Help
Entry
PN96_18050        CDS       T04636                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vna  Vibrio natriegens
Pathway
vna00071  Fatty acid degradation
vna00072  Synthesis and degradation of ketone bodies
vna00280  Valine, leucine and isoleucine degradation
vna00310  Lysine degradation
vna00362  Benzoate degradation
vna00380  Tryptophan metabolism
vna00620  Pyruvate metabolism
vna00630  Glyoxylate and dicarboxylate metabolism
vna00640  Propanoate metabolism
vna00650  Butanoate metabolism
vna00900  Terpenoid backbone biosynthesis
vna01100  Metabolic pathways
vna01110  Biosynthesis of secondary metabolites
vna01120  Microbial metabolism in diverse environments
vna01130  Biosynthesis of antibiotics
vna01200  Carbon metabolism
vna01212  Fatty acid metabolism
vna02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PN96_18050
   00630 Glyoxylate and dicarboxylate metabolism
    PN96_18050
   00640 Propanoate metabolism
    PN96_18050
   00650 Butanoate metabolism
    PN96_18050
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PN96_18050
   00072 Synthesis and degradation of ketone bodies
    PN96_18050
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PN96_18050
   00310 Lysine degradation
    PN96_18050
   00380 Tryptophan metabolism
    PN96_18050
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PN96_18050
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PN96_18050
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PN96_18050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vna04147]
    PN96_18050
Enzymes [BR:vna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PN96_18050
Exosome [BR:vna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PN96_18050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALR18861
Position
2:703600..704808
Genome map
AA seq 402 aa AA seqDB search
MEKVYIVAAKRTPIGAFGGSLKNTSAGNLAAVAIKGALEAANLGSDKIDEVIVGNVVSAG
QGMGVGRQAAIFAGIPESVPAYGVNMVCGSGMKTVMDAVSHIRSGDAQVVVAAGVEVMSQ
IPFIVPSSVRDGNKMGNMELKDLLITDGLTDIYNQYHMGVTAENVAKEVGISREQQDAYA
LASQQKAVAAIEAGKFKDEIVPVEVTQRRETIIFDTDEYPKANATLEGLSKLRPAFDREG
TVTAGNASGINDGASAIIVASESAVQAHGLTPLAEVVSYAQSGIDPKIMGLGPVESVNKA
LKKAELNIQDIDVYELNEAFAAQALGVIHQLAETNQVPVSSIQDKANFNGGAIALGHPLG
ASGNRILVTLVHELHKQDAQYGVASLCVGGGMGTAVILKAIK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtttatatcgtagcagcaaagcgtacacctattggcgcatttggtggaagt
ttaaaaaatacttcagcaggcaatctggcagcagtcgcaattaaaggggcgcttgaagct
gcaaatctcggcagcgacaagattgatgaagtgattgttggtaacgtcgttagtgctggc
caagggatgggcgtaggtcgtcaggcagcaatatttgcgggtattccggagtctgtacca
gcgtatggcgtcaacatggtttgtggtagtggcatgaaaaccgtgatggatgcggtttct
cacattcgcagcggtgatgctcaagtggttgttgctgcaggcgttgaggtgatgtctcaa
atcccgttcatcgttcctagtagcgtccgcgatgggaataaaatgggcaacatggaactg
aaagatcttttgatcaccgatggcctaacggacatttacaatcagtaccacatgggtgtg
actgcggaaaatgtggcaaaggaagtgggcattagccgcgagcagcaagacgcgtatgct
ttagccagccaacagaaagcggtcgccgcgattgaagcaggcaaattcaaagatgaaatc
gtaccggttgaagtaactcagcgccgtgaaacgattattttcgatacagacgaataccct
aaggcaaacgcgacacttgaaggcttgagcaagcttcgcccggcctttgaccgtgaaggt
acagtcacagcgggtaacgcatcaggaatcaacgatggagcgagtgcgatcatcgtggca
tcagaaagcgcggttcaagctcatggtttgacacctctggctgaggttgtcagttatgcg
cagtcaggtatcgatccaaagatcatggggctagggccagtcgagtcagtgaataaagcg
ctcaagaaagcagagcttaatattcaggatattgatgtatacgagctgaatgaagccttt
gccgctcaggctcttggggtgattcatcagttggcggaaacaaaccaagttccagtcagt
tcgattcaagataaagcaaactttaatggcggtgcgattgcattaggtcatccacttggt
gcctctggcaaccgaattctggtcactttagttcacgaacttcataagcaggacgcccaa
tacggtgtagcttcactgtgtgtgggtggcggtatggggacagctgtcattctaaaagca
attaagtaa

DBGET integrated database retrieval system