KEGG   Vibrio natriegens: PN96_19745Help
Entry
PN96_19745        CDS       T04636                                 

Definition
(GenBank) chemotaxis protein CheY
  KO
K07647  two-component system, OmpR family, sensor histidine kinase TorS [EC:2.7.13.3]
Organism
vna  Vibrio natriegens
Pathway
vna02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PN96_19745
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vna01001]
    PN96_19745
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vna02022]
    PN96_19745
Enzymes [BR:vna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     PN96_19745
Protein kinases [BR:vna01001]
 Histidine kinases
  OmpR family
   PN96_19745
Two-component system [BR:vna02022]
 OmpR family
  TorS-TorR (TMAO respiration)
   PN96_19745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg HisKA Hpt HAMP 4HB_MCP_1 DUF1497 HATPase_c_5 TGT_C1 DUF4064 T3SS_basalb_I
Motif
Other DBs
NCBI-ProteinID: ALR18172
Position
2:1102741..1105692
Genome map
AA seq 983 aa AA seqDB search
MLLATASIGRKLLLSFIAMAMLVMLSALIGMSGFSMVSKTERNVVDSAIPAMIEARQVSE
LSSRIISSVQTLSNAKNEFERQAAGRALFDQLEVLLSHIKKLGRDAFDSQLLDTLESHVQ
QVINNLGDLGTSVERKLYLAKEIETRVEEMRLLSEELEQLTRTQVQNTSTVAVANVTHIY
GLLEANKKEQAYQALDALVEVDLDLTERLHEFHLLAFQVLNQIEEARTLTNLDRIQQVQA
DFANNLRIMKRRVQAVEDPTLSTRMGQLLTDLGERQVVFSILMHQYENNEQSQQLMQRTL
ELFAELNSTVNKLVDDSNTATSVAIDEMTSSLTFAQWSLAIISVVGLIVAILIVWRVVYV
SVLKRLGEYSSALLSVAQGNLAVDLTVKGKDELAHMGRAIITARDTAQALKVVAEGEAKA
KKELEEHKEHLEELVEQRTSQLKQANYRLNEEVLNHAKARKQAEQASRAKSAFLSTMSHE
IRTPLNGVLGTARLLMDSGLNPLQKHYADIINRSGKTLLAIINDVLDYSKIEAGHLEIRH
SDFDLHQLVQDTYQLMESRAKEKNLLFSYHIESDVNKYWKGDATRINQVLNNLVGNAIKF
TQEGEIDIYVSLNPEDETQVLFEISDTGIGIADKEQTSLFDAFTQAEGGLSQTGGTGLGL
AISKRIIEAMDGTLAFESEKGQGSRFWFSLPLEKSDEVKTNAVVNTPCEVKAKVLLVEDN
EVNRVVAEGFLQSMGHEVVMAENGLQAEKILEKQDFDIALVDINLPDCNGADLIQRLKCI
EQNKPQRQANSPTPMVAVSAHVFEEEVERYLEAGFDGYLPKPLVKESLEVMIQEQLDGKP
LLLGQREQGSSHKEPVSTDDVLISVDNNPLAAEDIISPHVVLSDMKILGRERMLHIIDLF
RTSSLDALNQLEIAAEKDDTREVRSLSHKLKGSSGSLGLNTLMRTLQSIEAAENPLEAYK
QKKRVLADQVTASITALDELIAD
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atgctgctagcaaccgcaagtatcggtcgtaagcttttgctctcttttattgcgatggca
atgttggtcatgttgtctgcattgatcggcatgtctggcttttcgatggtgtcgaaaacg
gaaaggaacgtggttgattctgcgattcctgccatgatagaagcccgacaggtctctgaa
ctaagttctcgtattatttcttctgttcagacgctgtctaacgccaaaaatgagttcgag
cgacaagctgcggggcgagcgctttttgaccagctagaagtgttgctttctcatatcaaa
aagcttggaagagacgcgtttgattcccagctactcgatacgttagaaagccatgttcaa
caggttattaataacctgggtgatttgggcacatcggttgaacgtaagctctatctcgct
aaagagatagaaactcgggtcgaagaaatgcgtttgctcagtgaggaactggaacaactg
acccgaactcaagtgcaaaacaccagcactgtcgctgtcgcgaatgtgactcacatttat
ggtctgctggaagcaaacaaaaaagaacaggcttaccaagctctggatgcgttggtagaa
gtcgatttggatctgaccgaacggttgcatgagtttcatctgctggcgtttcaggttctc
aaccaaattgaagaagcgcgtacactgaccaatctagatcgtatccaacaagttcaggcg
gacttcgctaataaccttcgaattatgaagaggcgcgtgcaggcggtggaagatccgacg
ttgtcgacgcgaatggggcagctgcttacggatcttggtgaacgtcaggtcgtctttagc
atcttaatgcatcaatatgaaaataatgagcagtctcaacaattaatgcaaagaacactg
gagctatttgctgaacttaacagtactgttaataagttggttgatgattccaacactgcc
acgtcggttgcgatagatgaaatgaccagttcactcacatttgcacagtggtcattggcg
attatttcggtggttggcctcatagtggctattttaattgtttggcgtgttgtttatgtg
tcggtgctcaagcgacttggggagtattcatcagcgttgctgtcggtggcgcaaggcaac
ttagcagtggatctgacagtcaaaggaaaagatgaactcgcgcatatggggcgagctatt
attaccgcaagagacaccgctcaggcgttaaaagttgttgcagaaggtgaggcgaaggca
aagaaagaactcgaagagcataaagaacaccttgaagaattggtagagcaacgtacttct
cagctaaagcaagccaattaccgcttgaatgaagaggtattaaaccacgctaaagcacgt
aagcaggcagaacaagctagccgggctaagtctgccttcctttctacgatgagccatgaa
atacgtacacctttgaatggggtgctaggaaccgcacgtttgctcatggattcaggcttg
aatccactgcaaaaacactatgccgacatcattaatcgaagtggtaaaacgttacttgcc
atcatcaatgacgttctggattactcaaaaatagaagccggccatctcgaaatacgtcat
tcagacttcgacttgcatcaactggtgcaagacacttaccagctaatggaaagtcgtgcc
aaagaaaagaacttgttgttctcttaccatattgaaagcgatgtgaataagtactggaaa
ggtgacgcaacacggatcaatcaggtgctgaataatctggttggtaatgcgataaaattc
acccaagaaggggaaattgatatctatgtgagcctcaatcctgaagacgaaacgcaagtt
ctgttcgaaatttccgacactggtattggtatcgcggataaagagcaaacatcgctgttt
gatgcctttactcaagccgaaggtggattgagtcaaactggtggaacggggcttggcctt
gcgatcagtaaacgcattattgaagcaatggatggcacgttggcgtttgaatcagaaaaa
ggccaaggcagtcgtttttggttctcgttgccactcgaaaagagcgacgaagtaaaaaca
aatgcggttgtaaatacgccatgtgaagtgaaagccaaagtattgctggttgaagataac
gaagtaaaccgagtggttgcggaaggctttctgcagagcatggggcacgaagtcgtcatg
gctgaaaacggacttcaggcagaaaaaatattagaaaagcaggatttcgatatagcgtta
gtcgacatcaatttacctgattgcaacggcgccgatttaattcagcgtcttaagtgcatt
gaacagaataagcctcaacgacaagcgaactcgccaacaccgatggttgcagtttctgct
catgtatttgaagaggaagtggaacgctatctggaggcagggtttgatggttacttaccc
aagccattagtgaaagaatctcttgaagtcatgattcaagagcagttagacggcaaaccg
ttgttattgggccaaagagagcagggttcatcgcataaagaacccgtttccacagacgat
gttttgatatctgtagataataacccgcttgctgctgaagatattatttcaccacacgtt
gtgctttctgatatgaagattttgggcagagaaagaatgctgcacattattgatttattc
cgaaccagcagcctggatgctctcaatcaattagagatagccgcagagaaagatgacaca
cgtgaggtgaggtccttaagccataaactcaaaggaagttcgggtagtttaggcttaaac
acgctaatgagaacgttgcagagcatcgaagccgctgagaacccgctagaagcttacaag
caaaagaaaagggtgcttgctgatcaagtaaccgcatcgataaccgcgcttgatgaactg
atagcggattag

DBGET integrated database retrieval system