KEGG   Vibrio natriegens: PN96_22140Help
Entry
PN96_22140        CDS       T04636                                 

Definition
(GenBank) UDP-galactose-4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
vna  Vibrio natriegens
Pathway
vna00052  Galactose metabolism
vna00520  Amino sugar and nucleotide sugar metabolism
vna01100  Metabolic pathways
Module
vna_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:vna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PN96_22140
   00520 Amino sugar and nucleotide sugar metabolism
    PN96_22140
Enzymes [BR:vna01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     PN96_22140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD RmlD_sub_bind adh_short KR NAD_binding_10 NmrA
Motif
Other DBs
NCBI-ProteinID: ALR18599
Position
2:complement(1656587..1657597)
Genome map
AA seq 336 aa AA seqDB search
MRVLVTGGMGYIGSHTCVQMIEAGMEPIIVDNLCNAKTEVLSRIEALTGKQPTFYQGDIR
DEAFLDSVFAEHDIQAVIHFAGLKAVGESVVKPLEYYDNNVNGSLVLARSMRKAGVKSIV
FSSSATVYGDPEIVPITEDSPTGATTNPYGSSKHMVEACLSDLFNAESDWSITLLRYFNP
VGAHPSGSMGEDPQGIPNNLMPFIAQVAVGRREKLAVFGNDYLTPDGTGVRDYVHVMDLA
DGHIAALEAVGQKAGLHTYNLGTGKGSSVLEMVEAFGAACGKPVPYELCPRRPGDIAECW
ASTDKAERELGWKATRSVAEMTADTWNWQSNNPQGY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgagagtacttgtcacaggtggtatgggttacatcggcagtcacacatgcgttcagatg
attgaggcgggcatggagcccatcattgtcgataacttgtgtaacgccaaaacagaagta
ttgagccgtattgaagcgctaactggcaaacagccaactttttatcaaggcgatattcgt
gatgaagcgtttttggattcggtattcgctgagcatgatatccaagcggtcattcacttt
gcaggtctgaaagcggtaggtgagtcagtcgtcaagccattggaatattacgataacaat
gtcaatggctcattggtgttggcgcgtagtatgcgtaaagcgggtgtgaagagcatcgta
ttcagttcctcagcaaccgtctacggcgatccagaaatcgttccgatcacagaagactca
ccaacaggtgcaaccactaacccatacggtagtagtaaacacatggtggaagcgtgtttg
agtgatttgttcaatgctgaaagcgattggagcataactttgctgcgctactttaatcct
gttggcgcgcatccatcaggcagcatgggcgaagacccgcaaggcattccaaacaacttg
atgccgtttattgcacaagtcgcggttggtcgtcgtgaaaagctcgccgtatttggtaac
gactacctaacgccggatggtacaggtgtgcgtgattacgtccatgtaatggacctggct
gatggccacattgcggcactggaagctgtggggcagaaagcgggcttgcacacatacaac
ctagggacaggtaaaggttctagcgtacttgaaatggtggaagctttcggtgctgcctgc
ggtaaacctgtgccttacgaattgtgcccgcgtcgtccgggtgatatcgccgaatgttgg
gcgagcacagacaaggcagagcgcgagcttggttggaaagcaacacgcagcgttgctgaa
atgactgccgatacttggaattggcaatctaacaacccacaaggttactaa

DBGET integrated database retrieval system