KEGG   Virgibacillus necropolis: CFK40_00935Help
Entry
CFK40_00935       CDS       T04976                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
vne  Virgibacillus necropolis
Pathway
vne03010  Ribosome
Brite
KEGG Orthology (KO) [BR:vne00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CFK40_00935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:vne03011]
    CFK40_00935
Ribosome [BR:vne03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CFK40_00935
  Bacteria
    CFK40_00935
  Archaea
    CFK40_00935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ASN03677
UniProt: A0A221M7R5
Position
complement(169218..169559)
Genome map
AA seq 113 aa AA seqDB search
MQAKAVAKSVRIAPRKVRLVVDLIRGKNVGEAVAILRLTQRGASPVVEKVLNSAIANAEH
NYEMDPENLVVTEAFVNEGATLKRFRPRAQGRASKINKRSSHVTVVVSEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaaagccgttgcaaaatctgttcgtattgctcctcgtaaagtacgtttagta
gtagatttaattcgaggaaaaaatgttggtgaagctgtagcaattttacgccttactcaa
cgtggtgcttctccagtcgtagaaaaagttctaaactctgctattgcaaacgcggaacac
aactacgaaatggatccagaaaatctagttgttacagaagcattcgtaaatgaaggtgca
acattgaaacgttttcgtccacgtgcacaaggacgtgcaagtaaaattaataaacgctca
agccacgtaacagtggttgtatcagaaaagaaggagggatag

DBGET integrated database retrieval system