KEGG   Virgibacillus necropolis: CFK40_15995Help
Entry
CFK40_15995       CDS       T04976                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
vne  Virgibacillus necropolis
Pathway
vne00450  Selenocompound metabolism
vne00970  Aminoacyl-tRNA biosynthesis
vne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vne00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CFK40_15995
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CFK40_15995
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vne01007]
    CFK40_15995
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vne03016]
    CFK40_15995
Enzymes [BR:vne01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CFK40_15995
Amino acid related enzymes [BR:vne01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CFK40_15995
Transfer RNA biogenesis [BR:vne03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CFK40_15995
 Prokaryotic type
   Other AARSs
    CFK40_15995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ASN06411
UniProt: A0A221MFJ9
Position
complement(3375908..3377542)
Genome map
AA seq 544 aa AA seqDB search
MSIFIGGAWPYANGSLHLGHISSLLPGDILARYFRLKGEDVFYVSGSDCNGTPIAIKAKQ
EGVSIKNIADKYHNEFEENFTELGFTYDCYTRTDTKLHHEEVQSIFLQLLENNKIYKKVV
EQCYCNTCEQFLPDRFVEGVCPHCNQHARGDQCDYCSTILDPLELLDKKCKVCGDAPITK
DTEHFYFELSAFQNELEIYVSQARKSKSWRNNAIQLSERYLKEGLHNRAVSRDLPNGVSV
PVEGYRNKKIYVWIEAVSGYYSASRQWADENNEDDSLFWNDETTSYYVHGKDNIPFHTII
WPSILLGINKGSLPTHIASNEYLTIEQKKLSTSRNWAVWIPDILERYHPDSIRYFLTINA
PESRDADFSWREFVYSHNSELLGAYGNFVNRTLKFIEKSFDGQTLVGTIDAEFKTSVVEL
YEKVGTLISNTHFKAALEEVFKFVRHSNKYFDEQKPWVQIKENRSSCEETLANCVYIIAN
LAQLFSPFLPFSSQEVKRMLGLGDLKWEEIEVSSIVLTDVRPLFEKIDINRIEEELEKLN
SGVS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttttattggtggggcatggccctatgcaaatggttctttgcatttaggtcac
atatcaagtctattacccggggacatactagcgaggtattttcgtctaaaaggggaagat
gttttttatgtgtcaggaagtgattgtaacggcacacctatagctattaaggctaagcag
gaaggggtatcgatcaagaatattgctgataaataccataatgaatttgaggaaaacttt
actgagttaggatttacttatgattgttatacccgtacagatacaaaattgcatcacgaa
gaggtccaatctatttttcttcagttgcttgaaaataataaaatttataagaaggtagtt
gagcaatgctactgcaatacctgtgaacagtttttaccagacaggtttgtggaaggggtt
tgcccacattgtaatcaacatgccagaggtgatcaatgtgattattgctccactatctta
gacccattggagcttttagataaaaaatgtaaagtttgtggagacgcaccaattacaaag
gatacggaacatttttattttgaattaagtgctttccaaaacgagcttgaaatatatgtt
tcccaagcaaggaaaagtaaatcgtggcgaaataatgcgattcaattatctgaacgctac
ctaaaggaagggctgcataatcgtgcagtttcaagagatcttcctaatggggtaagtgtc
ccagttgaaggatatcgaaacaaaaaaatatatgtttggattgaagcagtttcaggttac
tattcggcaagtcgacaatgggctgatgagaataatgaggatgattctttgttttggaat
gacgagacaacctcttattatgttcatggaaaagataatatcccattccatacgattatc
tggccatccatacttttaggtattaacaaaggatctctccctactcacattgcttctaac
gaatatttaacaattgaacaaaagaagctttcgacaagtcgaaattgggctgtttggatt
ccagatattttagaaaggtaccatcctgattctattcgttactttttaacgattaatgct
cctgaaagtagggatgcagatttttcctggcgtgaatttgtttatagtcataatagcgaa
ttgctgggggcgtatggcaattttgtcaatagaacgttaaagtttatcgaaaagtcattt
gatggtcaaacacttgttggtacgatagacgcagaatttaaaactagcgttgttgaactt
tatgaaaaagttggcacattaatttccaacactcattttaaagcagccttagaggaagtt
ttcaaatttgtgcgtcactctaataagtattttgatgagcaaaagccttgggttcagata
aaggaaaatcgctcttcgtgtgaagaaacactggcaaattgcgtttacatcatcgcaaat
ctcgcacaactgtttagtcctttccttcctttttcaagtcaagaagttaaaagaatgtta
ggtttaggtgatctgaaatgggaggaaattgaggtgagctctatagtgctaacggatgta
agaccacttttcgaaaagattgatataaataggatagaagaggaactagaaaaactaaac
agcggagtatcctag

DBGET integrated database retrieval system