KEGG   Virgibacillus necropolis: CFK40_18125Help
Entry
CFK40_18125       CDS       T04976                                 

Definition
(GenBank) bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
vne  Virgibacillus necropolis
Pathway
vne00270  Cysteine and methionine metabolism
vne00670  One carbon pool by folate
vne01100  Metabolic pathways
vne01110  Biosynthesis of secondary metabolites
vne01120  Microbial metabolism in diverse environments
vne01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CFK40_18125
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CFK40_18125
Enzymes [BR:vne01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     CFK40_18125
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     CFK40_18125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR
Motif
Other DBs
NCBI-ProteinID: ASN06799
UniProt: A0A221MGT5
Position
3825956..3827815
Genome map
AA seq 619 aa AA seqDB search
MDLLKTLKERILIGDGAMGTLLYSYGVDRCFEELNLTHEVQIAHVHQAYIDAGADLIQTN
TYGANYIKLARYGLEDQVKKINTAAINIAKQVASDHTFVLGTIGGIHGTQTSLGTKEEIK
RSFREQLYCLLLGNVDGLILETYYNLDELTTVLEIAREETNLPIIANVSMHEAGILENGI
HLSDALQRLEDTGADIVGINCRLGPHHMVESLKNVPLSRNSFLASYPNASLPAYHDGKLI
YENEPDYFENCARDFRNEGVRLIGGCCGTTPEHIHALARGVKGLKPLTEKKIIKRPSSIK
VKENQVRTETPLLDIVKKRHTVIVELDAPKHLDTTEYMEGVRALKEVGVDAITLADNSLA
TPRISNLAIATKIKREIGLRPLVHLTCRDRNLIGLQSHLMGLHTLDINEILAITGDPTKI
GDFPGATSVFDVTSFDLIKLIKQSNDGLSFSGKSLRQATSFHVGAAFNPNVARLDKAVER
LEKKIACGTDYFLTQPIYSPEKIIDLAVATKHIDTPIFVGIMPLTSTKNAEFLHNEVPGI
KLTESIRAKMRSASADKEQSVEQGITIAKGLIDVALENFHGIYLITPFMRYDISIRLVEY
IQKKVQSKRLGEVLSTARL
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggatttattaaaaacattgaaagagcgcatcctgattggtgatggtgcgatggggact
ctactatattcttacggagtagatcgctgttttgaagaattgaacctgacacatgaagtg
caaatagcacatgttcatcaagcctatatcgatgctggagctgatttaatccagacaaat
acttatggggcaaattatatcaagcttgctaggtatggattggaagatcaggttaaaaaa
ataaataccgcagcaattaatatagccaaacaagtagctagtgatcatacatttgtcctt
ggaacaataggaggaatccatggaacgcaaacatcgctaggaacaaaagaggaaataaaa
agaagcttcagggaacaattgtattgcctgcttctaggaaatgtcgatggactgatattg
gaaacctattacaacctagatgaattaacaacagtcttagaaattgctcgggaagaaaca
aatctgccgataattgccaatgtgtccatgcatgaggccggtattcttgaaaatggaatc
catttatctgatgcattacaaagattagaggatacaggtgccgatattgtcggaatcaat
tgccggttgggcccgcaccatatggtggagtcattaaagaacgttccattatccagaaac
tcctttctggcatcctatccaaatgctagtttgccagcttatcatgatggcaagctaatc
tatgaaaacgagccagattacttcgaaaactgtgcacgtgattttcgtaatgaaggcgtt
cgattaatcgggggatgttgtggaaccacacctgaacacatacatgcattagcacgcggt
gtaaaaggattaaaacctttaacggaaaagaaaattatcaaaagaccctcatcaatcaaa
gttaaagagaaccaagtccgtactgaaacacccctactagatattgtaaaaaaacgacac
accgttattgttgagcttgatgcaccaaagcacttagatacaactgaatatatggaaggt
gtaagggcattaaaagaagtgggtgttgatgcgattacattggctgataattcactagca
acaccaagaataagtaacctagcaattgctacaaaaataaagcgagaaattggccttaga
ccacttgttcatttaacatgtcgagatcggaatttaattggactgcaatcccatttgatg
ggactgcacacactagatatcaacgaaatcctggcaatcacgggtgatccgactaaaata
ggcgattttcctggtgccacttccgtttttgatgtcacttcctttgatttaattaaatta
atcaaacaatccaatgatggtctttccttttccggaaagtcattaagacaggcaacctcc
tttcatgtgggtgctgcttttaatccaaatgttgcaaggcttgataaagcggtggaacga
ttagagaagaaaatcgcttgtggtacagactactttctaacacagcccatatacagcccg
gaaaaaatcattgacttagctgtagcaactaaacatattgatacacctatctttgttgga
attatgccgctaacttcaacgaaaaacgcagagtttctgcataacgaagtgccaggtatc
aagctaactgaaagcatacgggcaaaaatgcggtcagcaagcgcggataaagagcaatcg
gtcgagcaaggtattacaatcgcaaagggattaatcgacgttgctttggaaaacttccac
ggcatatatttaattacaccgttcatgcgttatgacatctccattcggcttgtggagtat
attcagaaaaaagtacaatcaaaacgccttggggaggtgttgtctactgcccgtttgtaa

DBGET integrated database retrieval system