KEGG   Virgibacillus necropolis: CFK40_18320Help
Entry
CFK40_18320       CDS       T04976                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vne  Virgibacillus necropolis
Pathway
vne00071  Fatty acid degradation
vne00072  Synthesis and degradation of ketone bodies
vne00280  Valine, leucine and isoleucine degradation
vne00310  Lysine degradation
vne00362  Benzoate degradation
vne00380  Tryptophan metabolism
vne00620  Pyruvate metabolism
vne00630  Glyoxylate and dicarboxylate metabolism
vne00640  Propanoate metabolism
vne00650  Butanoate metabolism
vne00900  Terpenoid backbone biosynthesis
vne01100  Metabolic pathways
vne01110  Biosynthesis of secondary metabolites
vne01120  Microbial metabolism in diverse environments
vne01130  Biosynthesis of antibiotics
vne01200  Carbon metabolism
vne01212  Fatty acid metabolism
vne02020  Two-component system
Module
vne_M00088  Ketone body biosynthesis, acetyl-CoA => acetoacetate/3-hydroxybutyrate/acetone
Brite
KEGG Orthology (KO) [BR:vne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFK40_18320
   00630 Glyoxylate and dicarboxylate metabolism
    CFK40_18320
   00640 Propanoate metabolism
    CFK40_18320
   00650 Butanoate metabolism
    CFK40_18320
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFK40_18320
   00072 Synthesis and degradation of ketone bodies
    CFK40_18320
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFK40_18320
   00310 Lysine degradation
    CFK40_18320
   00380 Tryptophan metabolism
    CFK40_18320
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CFK40_18320
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFK40_18320
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFK40_18320
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vne04147]
    CFK40_18320
Enzymes [BR:vne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CFK40_18320
Exosome [BR:vne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFK40_18320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ASN06835
UniProt: A0A221MGR9
Position
complement(3872722..3873888)
Genome map
AA seq 388 aa AA seqDB search
MREAVIVSAVRTPVARLGGALRDLHPSIYGGVVMKEALDRARVQGEEVDDVILGNCLAGG
GNVARLTALEAGLPVSIPGLTIDRQCGSGINSVALAAEAIMVGSGEILIAGGTESMTRMP
YLMEPPSKPFDRVPPKLIGKRKLSSERIGDPPMGITAENLVTQYKISREEQDQFALRSQK
NMKQAVENGLYEEQIVPVSLKNKKGEAVLFEKDEHPRSDTTSEGLGKLRPVFKEGGTVTA
GNSSGVNDGASALVMMSDKEAERRGLEPLARVTSWAVAGVDPNIMGIGPVPSTQKLLQKT
GLKLDDFDLIEINEAFAAQVLACDCELHFDWEKVNVNGGAIAHGHPIAATGGMLVMKLAY
EMKRRNVKRGLVTACIGGGQGIALMLER
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagcagtgatagtatctgcagtaagaaccccggttgccagacttggtggagca
ttaagggaccttcatccatctatttatggcggtgtcgttatgaaagaagcacttgatcgt
gcccgagtacagggagaagaagtggatgatgttattctcggaaactgtctcgctggcggt
ggaaacgtggcacgattgaccgcgcttgaggcggggcttccagtttcgattccgggactc
acaattgatcgccaatgtggttcaggaattaatagtgtcgcactggctgctgaagcgata
atggtcgggagcggagagatcctgattgcaggcggaacggaaagcatgacgagaatgcct
tacttaatggaaccgccgagcaaaccctttgatcgagttccacctaagcttatcgggaaa
cgtaagctttcttctgaacgaatcggggatccgccgatggggattacggcggaaaatcta
gtaacacaatataagattagcagagaagaacaggatcagtttgccctaagaagccagaag
aacatgaaacaggcagtcgaaaacggactttatgaagaacaaattgttcctgtgtcatta
aagaacaagaagggtgaggcggtactatttgagaaagatgaacatcctaggtctgatacg
acaagtgaagggttgggtaagcttcgcccggtttttaaggaaggcggaacagtgacagca
ggcaattcatctggtgtgaatgatggggcatcggctcttgtgatgatgtcagacaaggag
gcggaacgcagaggattggaaccacttgctcgggtcacaagctgggcggtggccggtgta
gatccgaatatcatgggaatcggtccggttccttctactcaaaagctgttgcagaaaacg
ggattaaagctagacgatttcgatttgattgaaatcaatgaggcatttgccgctcaagtt
ctcgcttgtgattgtgaattgcactttgattgggagaaggtaaatgtcaacggtggagcc
attgctcacggacatccgatcgcagctactggcggaatgctcgtaatgaaacttgcgtat
gagatgaaacgccgtaatgtaaaacgaggacttgtaacagcatgtatcggtggagggcag
gggattgcccttatgttagagcgctaa

DBGET integrated database retrieval system