KEGG   Virgibacillus necropolis: CFK40_18840Help
Entry
CFK40_18840       CDS       T04976                                 

Gene name
kynA
Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
vne  Virgibacillus necropolis
Pathway
vne00380  Tryptophan metabolism
vne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    CFK40_18840 (kynA)
Enzymes [BR:vne01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     CFK40_18840 (kynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase Hs1pro-1_C
Motif
Other DBs
NCBI-ProteinID: ASN06921
UniProt: A0A221MH15
Position
3971288..3972136
Genome map
AA seq 282 aa AA seqDB search
MSDKHENDSFKEEKGIHTDFIEKMTYGDYLQLDTLLASQKRLSNHHDEMLFIIIHQVSEL
WLKLIIHETKAAIEAIKQDDLQSSFKMLARVSKTQTQIIQAWDVLSTLTPAEYMEFRDKL
GNASGFQSYQYRLVEFVLGYKTHFILDIYKKDPELHAILEEAYHAPGLYDVAIQALARNG
FDIDKNILDRDFSETYSKDDSVEKAWLEVYKNVEDNWELYQLAEKLVDVEDSFQQWRFRH
MKTVERIIGHKIGTGGSSGVGYLKKVLDHYFFPELWDIRTKI
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagacaaacatgagaatgactcatttaaagaagaaaaaggcattcatactgatttc
atcgaaaagatgacgtatggtgattacttacaattagatacactattagcaagtcagaaa
cgcttatctaatcaccatgatgaaatgttgtttattatcatccaccaggtaagtgaacta
tggctaaagcttattattcatgaaacaaaggccgctattgaagcaattaagcaggatgat
cttcagtcatcctttaaaatgctagcccgtgtatctaaaacccaaacacaaattatccaa
gcttgggatgtcctttcaaccttaactcccgcggaatacatggaatttcgcgataaactt
ggtaatgcttcaggttttcaatcgtatcaatatcggttagttgaatttgtgctaggctat
aaaacacattttatcctagacatttataaaaaagacccagaattacatgcaatactggaa
gaagcctatcacgcaccaggactttatgatgtagcgattcaagcacttgcgcgaaacggc
tttgacatagacaaaaacatcctagaccgtgatttttcagaaacctattcaaaagatgac
tcagttgagaaggcttggcttgaggtttataaaaatgttgaagataattgggaactttac
cagctggcagaaaagctcgtagatgttgaggattcgtttcaacagtggcgattccgtcat
atgaaaacagtggagcgaattattggacataaaattggcactggcggctcgtctggtgtt
ggctatttgaaaaaggtattggatcattactttttcccagaattatgggatattcgtaca
aaaatataa

DBGET integrated database retrieval system