KEGG   Vibrio nigripulchritudo: VIBNI_A2547
Entry
VIBNI_A2547       CDS       T02871                                 

Definition
(GenBank) putative Fe2+ transport system protein B
  KO
K04759  ferrous iron transport protein B
Organism
vni  Vibrio nigripulchritudo
Brite
KEGG Orthology (KO) [BR:vni00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vni02000]
    VIBNI_A2547
Transporters [BR:vni02000]
 Other transporters
  Others
   VIBNI_A2547
SSDB
Motif
Pfam: FeoB_N Gate MMR_HSR1 FeoB_C GTP_EFTU RsgA_GTPase FeoB_Cyto SRPRB DUF1189 PduV-EutP HMGL-like HCV_NS2 AAA_33
Other DBs
NCBI-ProteinID: CCO58605
UniProt: U4K034
Position
1:complement(2709504..2711777)
AA seq 757 aa
MQYDILTIGNPNSGKTTLFNALTGAKQHVGNWAGVTVEKKTGHFEHAGDRFALTDLPGIY
ALDSADDANSIDESIASRAALTHPTDLIINVVDATCLERSLYMTLQLRELGRPMIVVVNK
MDALTRARQTLDIKALESTLGCPVFALSANNKQQTRTFREQLHKWLVQGLPVEEFTLDYG
NELELAIDQVVKTFDNKNNSRALALRALGQDPLVVNALDDNQRQAVLRQNAALDIDVDFQ
VANVKYTFLHQVCQRVRKDKGKLSRNTTQMIDNLVLNKWIGIPFFFFVMYLMFMFSINIG
SAFIDFFDIGVGALLVDGGHYLLDDHLPVWLVTLLADGVGGGIQTVATFIPVIACLYLFL
ALLESSGYMARAAFVLDKVMQKIGLPGKAFVPLVLGFGCNVPSVMATRTLDQERERKLAA
AMAPFMSCGARLPVYALFAAAFFPEAGQNVVFVLYLLGILAAVGTGLLLKKTLYPGSSEH
FIMEMPSYEFPTVQNVLLKTWQKLNRFVLGAGKTIVVVVTILSFFNSLGTDGTFGNEDSE
QSVLSQAAQIVTPVFEPIGVKEENWPATVGIITGIFAKEAVVGTLNSLYSTPTDEAASEF
DLWGSLNEAVNTIPENLSGLSYSDPLGIEVGDLTDSNAVAEEQEVDSSTFGNLQHFFVTG
NAAFAYLIFILLYTPCVAAMGAYVREFGHKFARFIAVWTMLLAYGSATLYYQVTHFAEHP
VYSAFCITVVSLLFVGTYLLLKREGEKQTQLSEVAVA
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgcaatacgacattttaacaataggcaacccaaacagcggcaaaaccactttatttaat
gcgcttactggcgcaaaacaacatgttggcaactgggcgggcgtaactgttgaaaagaaa
acgggtcattttgaacacgcaggcgaccgattcgcgctgaccgatcttccgggtatctat
gcactagacagtgcggatgatgccaacagtattgacgagtctatcgcatccagagcggct
ttgactcatccaacagatttaattatcaatgttgtagatgccacgtgtctggaacgcagc
ttatatatgacacttcagcttcgtgaactgggcagaccaatgattgttgtcgtcaataag
atggatgctctgactcgcgctcgtcaaactctagacatcaaagcactggaatccactctt
ggctgtccagtgtttgcattgtcagcgaataataaacagcaaacacgcaccttccgtgaa
caacttcataaatggcttgttcagggtttacctgtcgaagaatttactctggattatgga
aacgaacttgagctggctattgatcaagttgtgaaaactttcgacaacaaaaacaactct
cgggcacttgcattaagggcgctagggcaggacccacttgtggtcaacgcgcttgatgat
aaccagcgacaagctgtgctccgtcaaaatgctgcgttagatattgacgtagatttccaa
gttgccaacgttaaatacacgttcttacatcaggtttgccagcgtgtccgtaaagacaaa
gggaagctcagtagaaatacgactcagatgatcgataacctggtcctgaacaaatggata
ggtattcctttcttcttctttgttatgtacctaatgtttatgttctctatcaacataggc
agcgcatttattgatttcttcgacatcggtgtgggcgcactgctggtggatggtggacat
tatctgcttgatgaccacttacctgtctggctagtgaccttgttggcagatggcgttggc
ggcggtattcaaactgtggcgacctttattcctgttattgcctgcctgtatctgtttttg
gctttgctggaaagttctggttacatggcaagagcggcgtttgtcctcgacaaagttatg
caaaaaatcgggctacccggcaaagcctttgttccgctggtgcttgggtttggttgtaac
gttccttctgtgatggcgacgcgcacgcttgatcaggaacgcgaacgcaaactggcggca
gcgatggcaccatttatgtcctgtggcgccagacttcctgtttatgcgctttttgcagcc
gcgttttttccagaagcgggtcagaatgtggtgtttgtgttgtacctgcttggaattctg
gcagcagtcgggacagggttacttcttaagaaaaccctttacccgggttccagtgagcat
ttcattatggaaatgccaagctatgaatttccaaccgtgcagaacgtgttgttgaaaacc
tggcaaaagctcaatcgatttgtattaggggcgggtaaaaccatcgtcgttgtggtcact
attcttagctttttcaattcactggggactgacggaacctttggaaacgaagactcggag
cagtctgttctgtctcaggctgcacaaattgtcactcctgtatttgagccgattggagtt
aaggaagaaaactggccagcaacggtaggtattattacgggtatttttgctaaagaagcc
gtagtcggcacattaaacagcctttactcaacaccaactgacgaagcagcgtcagagttt
gatctatggggcagcttgaatgaagccgtcaataccatacctgaaaacctgtctgggctt
agctacagcgatccgctgggtatagaagttggtgaccttaccgattcgaatgcagtggcg
gaagaacaggaagtagacagcagtacctttggtaaccttcagcatttctttgtgacaggg
aatgccgcatttgcttatctcattttcattcttttgtatacgccttgcgtcgcggcaatg
ggggcgtatgtcagggaatttgggcataaatttgcgcgctttattgcagtatggaccatg
cttctggcttatggaagcgccacactttattaccaggtgactcactttgcggaacatcca
gtttacagcgcattctgtattaccgttgtatcgctattgttcgttggtacttacttactc
ttaaaaagagaaggagaaaagcagacccaactcagcgaggtagccgtggcatga

DBGET integrated database retrieval system