KEGG   Vibrio nigripulchritudo: VIBNI_B0465Help
Entry
VIBNI_B0465       CDS       T02871                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vni  Vibrio nigripulchritudo
Pathway
vni00071  Fatty acid degradation
vni00072  Synthesis and degradation of ketone bodies
vni00280  Valine, leucine and isoleucine degradation
vni00310  Lysine degradation
vni00362  Benzoate degradation
vni00380  Tryptophan metabolism
vni00620  Pyruvate metabolism
vni00630  Glyoxylate and dicarboxylate metabolism
vni00640  Propanoate metabolism
vni00650  Butanoate metabolism
vni00900  Terpenoid backbone biosynthesis
vni01100  Metabolic pathways
vni01110  Biosynthesis of secondary metabolites
vni01120  Microbial metabolism in diverse environments
vni01130  Biosynthesis of antibiotics
vni01200  Carbon metabolism
vni01212  Fatty acid metabolism
vni02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VIBNI_B0465 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    VIBNI_B0465 (phbA)
   00640 Propanoate metabolism
    VIBNI_B0465 (phbA)
   00650 Butanoate metabolism
    VIBNI_B0465 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VIBNI_B0465 (phbA)
   00072 Synthesis and degradation of ketone bodies
    VIBNI_B0465 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VIBNI_B0465 (phbA)
   00310 Lysine degradation
    VIBNI_B0465 (phbA)
   00380 Tryptophan metabolism
    VIBNI_B0465 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VIBNI_B0465 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VIBNI_B0465 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VIBNI_B0465 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vni04147]
    VIBNI_B0465 (phbA)
Enzymes [BR:vni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VIBNI_B0465 (phbA)
Exosome [BR:vni04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VIBNI_B0465 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CCO60277
UniProt: U4K4S4
Position
2:complement(490674..491882)
Genome map
AA seq 402 aa AA seqDB search
MEPIYIVAAKRTPIGNFNGGLSSLSAVELGAHAMKAAIEQSGIAPDKIDEVIVGNVLTAG
NGMGTGRQASIHAGIPSSVPAYTLNMICGSGMKALTDAASHIRAGDCEVVMTCGMESMSN
AGFVLSGDNRRGHRMGHQTVVDTILKDGLTDAFHGYPMGITAENIVDKLDISRHQQDEYA
LSSQQKAIRAQDQGHFDEEIAPVTIATRKSEITIAKDEFPKRDCTLEKLSGLHPAFDKQG
SVTAGNASGINDGASAILLASTSAVKKHNLTPLAELVEYGQAAIEPEVMGLGPVNAIANT
LRKADMSLGQIDCFELNEAFAAQSLGVIKQLSEQHDVSEHWIAERSNPNGGAIALGHPIG
ASGNRIVTTLVYQLRRDNSEFGLASLCIGGGMGTAVIVKPCR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaacccatttatatcgtcgctgcgaaacgtaccccaataggcaatttcaatgggggg
ttatcttcactcagtgcggttgaacttggcgcacatgcgatgaaagcggctattgagcaa
tcaggtattgcccccgacaaaatagatgaagtgatcgtcgggaatgtgctcaccgcaggc
aatggaatgggaacggggagacaagcctcgatccacgctgggatcccgtcatcggttccg
gcttatacccttaacatgatttgtggcagtggcatgaaagccctgaccgatgccgccagc
catattcgtgcgggtgactgtgaagtggtaatgacctgcggtatggaaagcatgtccaac
gccgggtttgtgctttctggtgataatcgccgcgggcaccgcatggggcatcaaacggtg
gttgatacgattttaaaagacggactgaccgatgcttttcatggttaccctatgggaatt
acagcagagaacattgtcgataagctcgatatatcacgccatcagcaggacgaatacgct
ctcagcagccagcaaaaagccattagagctcaagaccaagggcactttgatgaagaaatt
gcccccgtcaccattgccactcgcaaatccgaaatcactatcgcgaaggatgagtttccc
aagcgcgactgcactctagaaaaactgagtggtctgcatcctgctttcgataaacaaggc
agtgtaacggctggcaatgcctctggaattaatgatggcgcatccgccattctgctggct
tccactagcgcagtgaaaaaacacaacctgacgccgctggctgagttggtggaatacggt
caggctgccattgagccagaagtaatggggctcggtcctgttaacgccattgccaatacg
ctgcgaaaagccgatatgtcgcttgggcagatagactgttttgagctcaatgaggctttt
gctgctcagtcacttggtgtgattaaacaactgagcgagcaacatgatgtatcggaacac
tggatagctgaacgcagtaacccaaacggtggagccatcgcgctcggtcaccccattggg
gcttctggcaatcgcattgttaccaccttggtttaccagcttagaagagacaatagcgaa
ttcggtcttgcgtctttgtgtattggtggtggcatgggcaccgctgttattgtgaaacca
tgtaggtaa

DBGET integrated database retrieval system