KEGG   Vibrio nigripulchritudo: VIBNI_B1226
Entry
VIBNI_B1226       CDS       T02871                                 

Definition
(GenBank) putative Aspartoacylase
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
vni  Vibrio nigripulchritudo
Brite
KEGG Orthology (KO) [BR:vni00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VIBNI_B1226
Enzymes [BR:vni01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     VIBNI_B1226
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-ProteinID: CCO60988
UniProt: U4KDE4
Position
2:1253659..1254531
AA seq 290 aa
MDKVNQVLLVSGTHGNELSGIYLHKLIKDGLYPASRDSFSFESIIANPLSMEQNCRFVDH
DLNRLFSSTTPEEEPDSHEVNLAKQLKDKYSERSNQLVIDLHNTTSNMGATLILLADSPF
YQQMGAYVKQRMPNAYILFESQQSWDEHPYLCTLGQHGVMIEVGAQAHGSLKSDTLDLMK
TMLTAVLDFVENHNLNRLPALNNYDAFYLFEEVKIPLDETGMRIATVHPTICGRDFEAVK
PGEPILSTFAGGDYSWEGKHDVYPHFINESAYCKSNIAMALAKKKQVKVG
NT seq 873 nt   +upstreamnt  +downstreamnt
atggacaaagttaaccaagtacttctcgtttcaggtactcatggcaacgaactttctggc
atataccttcataaactgattaaggatggcttgtatcccgcaagccgggattcgttttcg
ttcgaatccatcatcgcaaacccgctctcaatggaacagaactgtcgctttgttgatcac
gatttaaaccgactcttttcctctaccacaccagaagaagaaccagactcccacgaggta
aacttagccaagcagttaaaagacaaatactcagagcgaagcaatcagctggtcattgat
ttacacaataccaccagcaatatgggtgcaacgcttattctgcttgctgattctcctttc
tatcaacaaatgggagcctacgttaagcagcgaatgcccaatgcctatattctttttgaa
tctcagcaatcgtgggatgaacatccttatctatgcacacttgggcagcatggcgtgatg
atagaagttggtgctcaggcacatggttcattgaagtcagacactctggatttgatgaaa
accatgttaacggcggtgctggattttgtcgaaaatcacaacctcaacaggcttcctgcc
ctaaacaactatgacgctttctatctatttgaagaagtgaaaattccactcgatgaaacc
ggtatgcgcattgcgaccgttcacccgacgatttgcggcagagatttcgaagcagtaaaa
cccggagaacctatcttatcgacattcgccgggggggattattcttgggaaggaaagcat
gatgtgtacccacatttcattaatgaaagtgcttactgcaagagcaatattgccatggca
ttagcgaagaaaaagcaggttaaggtgggttaa

DBGET integrated database retrieval system