KEGG   Vibrio nigripulchritudo: VIBNI_B1828Help
Entry
VIBNI_B1828       CDS       T02871                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
vni  Vibrio nigripulchritudo
Pathway
vni00030  Pentose phosphate pathway
vni00480  Glutathione metabolism
vni01100  Metabolic pathways
vni01110  Biosynthesis of secondary metabolites
vni01120  Microbial metabolism in diverse environments
vni01130  Biosynthesis of antibiotics
vni01200  Carbon metabolism
Module
vni_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
vni_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:vni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VIBNI_B1828 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VIBNI_B1828 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vni04147]
    VIBNI_B1828 (zwf)
Enzymes [BR:vni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     VIBNI_B1828 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     VIBNI_B1828 (zwf)
Exosome [BR:vni04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   VIBNI_B1828 (zwf)
  Exosomal proteins of colorectal cancer cells
   VIBNI_B1828 (zwf)
  Exosomal proteins of bladder cancer cells
   VIBNI_B1828 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N SRX
Motif
Other DBs
NCBI-ProteinID: CCO61551
UniProt: U4KEI2
Position
2:complement(1875774..1877276)
Genome map
AA seq 500 aa AA seqDB search
MVIPENSCIVIFGASGDLTYRKLIPALYHLYANKQLPESFAILGVSRTEYSDESYRDKLK
RSLQEMEKTEPETLDAFIDHLHYQAINTSDTSDYAKLATRLDTLSDTYQFEQSNILFYLA
TPPSLYSVIPAALAAHGLNDESKGWRRLIIEKPFGYDLESAQKLDKEIHEHFQEHQIYRI
DHYLGKETVQNLLVFRFSNAMFEPLWNRNFIDYVEITGAEFLGVEERGGYYDGSGAVRDM
FQNHLLQVLAMVGMEPPAQINADSMRDEVVKVLQCLKPLDESDLRNNLVLGQYTGSDVRG
EFLPGYREEPGVAEDSRTETYVGLKAYINNWRWNGVPFYVRTGKRLPTRVTEVVIHFKRT
PHPVFGLDAPENKLIIRIQPDEGIQMSFGLKEPGAGFNAKEVKMNFHYASLEETQMLTAY
ERLLLDALNGDATLFARSDAVEACWQYVQPILDFKQDPQALFGYACGTWGPIESDKLLQR
DGRAWRFPCKNLTDTDYCEL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggtaatacctgaaaacagctgcatcgttatcttcggtgcctctggcgatttgacttac
cgtaagctgatccctgctttataccatttgtatgcaaataagcagcttccagagtccttt
gcgattttaggcgtgagtcgtaccgagtacagcgacgagtcttatcgcgacaagttgaaa
cgctctcttcaggaaatggaaaaaacggaacctgaaacgttagatgcgtttattgatcac
cttcattaccaagcgatcaatacttctgacactagcgattacgcaaaactggcgacgcgt
ctggatacactgtccgacacttaccagtttgaacaaagcaacatcctcttctacctagcc
actccaccaagcctgtacagcgtgattccagcagcacttgctgctcatggtcttaacgac
gaaagtaaaggctggcgtcgtcttattattgaaaaaccatttggttacgatctggaatcg
gctcagaagctggataaagaaatccacgaacattttcaggaacaccagatttaccgcatc
gaccattacctgggtaaagagacggttcaaaacctgctggttttccgcttctctaacgcg
atgtttgaaccactgtggaaccgtaacttcattgattacgttgaaatcacaggcgcagag
ttcttaggtgttgaagagcgcggcggatactacgacggctctggtgcggttcgcgacatg
ttccaaaaccacttgctacaagtactggcaatggtgggtatggagccgcctgcacaaatc
aacgcagattctatgcgtgatgaagtggtaaaagtgcttcagtgcctgaagccgcttgat
gaatcagaccttcgaaacaaccttgttttgggtcagtacacaggttctgatgtacgtggt
gaattcctaccgggttaccgtgaagagccgggtgtggcagaagattctcgtaccgagact
tatgttggcttgaaagcttacatcaacaactggcgttggaatggagtgccattctacgtt
cgtaccggtaagcgtttgccaactcgtgtaacagaagtggtcattcactttaaacgcacg
cctcatccagtattcggtttggatgcgccagaaaacaaactgatcatccgtattcaaccg
gacgaaggcattcagatgagctttggtctgaaagagccgggtgcaggtttcaacgcgaaa
gaagtgaaaatgaacttccattacgcttctctggaagaaacgcaaatgctgacggcatac
gagcgtctgcttcttgatgcgctaaacggtgatgctactctgtttgcccgtagtgatgca
gtagaagcttgttggcaatatgttcagccgattctggacttcaaacaagatccacaagcg
ctgtttggctacgcatgtggaacatggggaccaatcgaatccgacaagctgcttcagcgc
gacggacgtgcatggcgcttcccttgtaagaaccttaccgacacggattactgcgaacta
tga

DBGET integrated database retrieval system