KEGG   Candidatus Vesicomyosocius okutanii (Calyptogena okutanii): COSY_0130Help
Entry
COSY_0130         CDS       T00530                                 

Gene name
pitA
Definition
(GenBank) Na(+):phosphate symporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
vok  Candidatus Vesicomyosocius okutanii (Calyptogena okutanii)
Brite
KEGG Orthology (KO) [BR:vok00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    COSY_0130 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF3852
Motif
Other DBs
NCBI-ProteinID: BAF61264
UniProt: A5CXN9
Position
140073..141353
Genome map
AA seq 426 aa AA seqDB search
MDIIANYADIFIMLSIGFGLFMAWGIGANDVSNAMGTSVGSAAITFKQAVVIAVIFEFSG
AILAGGEVTDTVRKGILDAVLFTNNPHLLVYGMLASLLAAGAWLLIASSLGWPVSTTHSI
VGAIVGFGAVGVGIDAVAWDKVIKIVMSWVVSPVLAGTLAVFIFKSLQFLVIDTKDPLIN
AKRYLPFYVFFVGFIIALVTQFKGLKHIDSLKYISKNVSLSLIIAIIVGIFAAVIAAFIM
RNIKINPKDDKDFHYANMEKLFAVLMVITASAMAFAHGSNDVANAIGPLAAVYSIVEAGG
DITSRSAIPSWVLLVGGGGIIFGFVTYGFKVMKTIGQGITELTPSRGFAAELAAATTVVL
ASSTGIPVSTTQVLVGAVLGVGIARGVVALNMRVINTIFLSWLITLPAGAVMSILFFFAL
KGVFGA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggatataattgcaaattatgctgatatttttattatgctgtcaattgggtttggtttg
tttatggcttggggtattggtgctaatgatgtttctaatgctatgggtacttcggtgggt
tctgctgctattacctttaaacaagcagttgttattgcggttatttttgagttttctggt
gcaattcttgcaggcggagaagtaactgatactgttcgtaaaggtattttagatgcagta
ttatttactaataatccacacttactggtgtatggtatgcttgcttcgctcttggcagca
ggtgcgtggttattgattgcctcatccttaggatggccagtttctacgacacattcaatt
gttggtgctattgttggttttggtgcagtaggtgttggtattgatgcagttgcttgggat
aaagtaattaaaattgtgatgagttgggtagtatctccagtacttgctggcacacttgct
gtttttatctttaaaagtctacaattcttagtgattgatactaaagatccgttgataaat
gccaagagatatttgccattttatgtattttttgttggttttattattgcgttggttacg
caatttaaaggtcttaaacatattgactctttaaaatatatctctaaaaatgtttcttta
agtttgataattgcaattatagttggtatttttgcagctgttattgctgcgtttattatg
agaaatattaagataaatcctaaggatgataaagattttcattatgctaacatggaaaag
ctttttgctgtgcttatggtgattaccgcatctgctatggcatttgcacatggctctaat
gatgttgctaatgccattggtccattggctgcggtttatagtattgtagaagctggcggt
gatattacctcaaggagcgctataccttcatgggttttgctagttggtggcggtggcatt
atatttggtttcgtgacttatggatttaaagttatgaaaactattggccaaggaattaca
gaacttaccccttctcgtggttttgctgctgaattagccgctgcaacaacggtagtttta
gcctcatcaacaggtattcctgtatcaactacacaggtcttggtaggggcggtgttgggt
gttggtattgctaggggtgtagttgcacttaatatgcgagttataaatacaattttttta
tcttggttaattaccttgccagcaggtgcagtcatgtctattctatttttctttgcactt
aagggagtatttggagcataa

DBGET integrated database retrieval system