KEGG   Candidatus Vesicomyosocius okutanii (Calyptogena okutanii): COSY_0174Help
Entry
COSY_0174         CDS       T00530                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
vok  Candidatus Vesicomyosocius okutanii (Calyptogena okutanii)
Pathway
vok03010  Ribosome
Brite
KEGG Orthology (KO) [BR:vok00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    COSY_0174 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:vok03011]
    COSY_0174 (rplV)
Ribosome [BR:vok03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    COSY_0174 (rplV)
  Bacteria
    COSY_0174 (rplV)
  Archaea
    COSY_0174 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: BAF61304
UniProt: A5CXK9
Position
184366..184698
Genome map
AA seq 110 aa AA seqDB search
MKEVKAVHKYAKTSAFKARLVADQIRLKSVEEALNILSFSNKKAAVLVKKVLNSVISNAE
HNDGLDIDELFVTSIYIDEGSTMKRIRPRAKGRANRILKRTSHITVGIGK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagttaaagcagtgcataaatatgcaaaaacatccgcttttaaagcaagatta
gttgcagatcaaattcgtcttaaatcggtagaagaggcattaaatattttatcatttagc
aataaaaaagccgcagtcttagttaaaaaagtactgaattcagttatttctaatgctgag
cataatgatggactagacattgatgaattatttgtcactagtatttatattgatgaaggt
tcaaccatgaaaagaattcgtccaagagcaaaaggaagggcaaataggattttaaaaaga
acaagccacattacagttggcataggcaagtag

DBGET integrated database retrieval system