KEGG   Candidatus Vesicomyosocius okutanii (Calyptogena okutanii): COSY_0487Help
Entry
COSY_0487         CDS       T00530                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
vok  Candidatus Vesicomyosocius okutanii (Calyptogena okutanii)
Pathway
vok00230  Purine metabolism
vok00250  Alanine, aspartate and glutamate metabolism
vok01100  Metabolic pathways
Module
vok_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:vok00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    COSY_0487 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COSY_0487 (purA)
Enzymes [BR:vok01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     COSY_0487 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: BAF61606
UniProt: A5CWQ5
Position
complement(509294..510610)
Genome map
AA seq 438 aa AA seqDB search
MSKNVVIIGTQWGDEGKGKIVDLISDRAVSVVRFQGGHNAGHTLVIDQQTTVLHLIPSGI
LHDHVECLIAHGVVLSMSALLKEIAELEGANINVTERLKISPGCPLIFPYHIALDNAREA
KCGKTAIGTTGNGIGPTYEDKVARRGLRAGDLLNPILFASKLKEVVEYHNFLLTNYYGTA
PVDYQVILYEALSQAKKIKHMIIDVTEKIHQHIANDENILFEGAQGTLLDIDQGTYPFVT
SSNTTSGGAVTGSGVGVTDINYVLGIVKAYTTRVGSGPFPTELIYNVSTNKGDAIGKVLG
TVGHEFGATTGRQRRCGWLDMVTLKRSFNLNAVTGICLTKLDVLDSLISVKICVAYKLNG
KEVTIPPYDAKGYTDAKPVYIEMPGWKTSTIGTNSFDSLPIEAQNYIHKIEQLANLPVDI
LSTGPDRTQTLILKHPFE
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaatgtagtgattattggcacccagtggggtgatgaaggtaaaggtaagata
gttgatttaatctcagatagagcagtaagcgtggtgcgttttcaaggtgggcataacgca
ggtcataccttggtcattgatcaacaaacaactgtactacatcttattccttcaggtatt
ttacacgaccatgttgaatgtttaattgcccatggagtggtattatcaatgtctgcttta
ttaaaagaaatagcggagttagaaggtgctaatattaatgtaacagagcgtttaaagatt
agcccaggttgccccttaatttttccatatcacattgctcttgataatgctcgagaagca
aagtgtggtaagactgctattggcacaacaggtaatggtattggccctacttatgaggat
aaagttgctcgtcggggcttgcgtgcaggagatttattgaatccaatcctgtttgcctca
aaacttaaagaagttgtagaataccataactttttattgactaactattatggtacagct
cctgttgattatcaagttattttatatgaagctctatctcaagcaaaaaaaattaagcat
atgattattgatgtaacagaaaaaattcatcagcatattgctaatgatgaaaatatacta
tttgaaggtgcacaaggtacattattagacattgatcaaggtacttatccatttgttact
tcttcaaacacaacttctgggggtgcggttactggttcaggtgttggagtaacagatatt
aattatgtactaggaattgttaaagcttatacaacacgagtaggtagtggtccattcccg
actgagctaatttataatgtttccactaataaaggtgatgcaattggtaaagtattaggt
acagttggccatgaatttggtgcaactacaggtcgtcagcgtcgttgtggttggttggat
atggttacattgaaacgttcatttaatttaaatgctgttactggtatttgtcttaccaag
cttgatgttttagattcattaataagtgttaaaatttgtgttgcttataaattaaatggc
aaagaagttacaataccgccatatgatgccaaaggatacacagatgcaaaaccagtttat
attgaaatgcctggttggaaaacttcaaccattggtactaattcatttgactctttacct
attgaagcacaaaactacatccataaaattgagcagttagctaatcttccggtggatatc
ttatccaccggtccagacagaacacaaactctaattttaaaacatccattcgagtaa

DBGET integrated database retrieval system