KEGG   Candidatus Vesicomyosocius okutanii (Calyptogena okutanii): COSY_0554Help
Entry
COSY_0554         CDS       T00530                                 

Gene name
murA
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
vok  Candidatus Vesicomyosocius okutanii (Calyptogena okutanii)
Pathway
vok00520  Amino sugar and nucleotide sugar metabolism
vok00550  Peptidoglycan biosynthesis
vok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vok00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    COSY_0554 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    COSY_0554 (murA)
Enzymes [BR:vok01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     COSY_0554 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:vok01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   COSY_0554 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase GHMP_kinases_C HupE_UreJ
Motif
Other DBs
NCBI-ProteinID: BAF61671
UniProt: A5CWI9
Position
581526..582785
Genome map
AA seq 419 aa AA seqDB search
MYKLIIHGGISLNGSVITAGSKNSSLPILFASILANGPITLTNTPHLSDVSTTLRLLMDM
GAEFILESDNSLFINGSKLTNLVAQYNLVKTMRASILALGPMLAKYGKAKISLPGGCAIG
PRPVNLHLEALENLGATIKVKNGYIYATAKELIGTKIHFKQISVTATENIIMAATLATGI
TTIYNAAQEPEIVDLVKCLIKMGAIISGAGTSIIIIQGVDELSGVTYSVCPDRIEAGTYL
VATAITGGKITIKNVHYQSMHAILEKLLETGADIKTNKNSIILDMKGKRPRAVNIKTSTY
PNFPTDMQAQFTALNAIADGYSTITETIFENRFMHIPELSRMGANLVLKGNTVVCKGVKY
LTGMPLIATDLRASASLVLAGLVATGTTTIERVYHLDRGYETIEEKLKLLGAQIERVQD
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaacttattattcatggcggtatctcgttaaatggtagtgttataactgcggga
tcaaaaaattcatctctacccatcttatttgcctcaatattagctaatggccctatcact
ttaaccaatacacctcatttaagtgatgtttcaaccacacttagattattaatggatatg
ggtgcagaatttatactagaatcagataattctttatttataaatggttctaaattaaca
aacttagtcgctcaatacaatttggttaagactatgcgtgcttcaattttagcattaggg
ccaatgcttgctaaatatggcaaggcaaaaatatctctacctgggggttgtgcaattggc
ccacgtcctgttaatttacacttagaagcattagaaaatttaggagcaacaattaaagtc
aaaaatggttatatttatgccacagctaaagaacttattggtactaaaattcattttaaa
caaatttcagtaactgctactgaaaatataattatggcagcaactttagcaacaggtata
actacaatttataatgctgcacaagaacctgaaattgtagatttagtcaaatgtttaatc
aagatgggggctattatttccggtgctggtacttcaattattattatccaaggagttgat
gaattatcaggcgtaacttattcagtttgtcctgatcgaattgaagcaggtacttatctt
gttgctacagctatcacaggtggtaaaattacgattaaaaatgtgcattatcaatcaatg
catgccattctcgaaaaactacttgaaaccggcgcagacattaaaactaataaaaattca
atcatccttgatatgaaaggaaaacgacccagagctgttaatatcaaaactagtacttat
ccaaattttcccacagatatgcaggcacaatttacagcacttaacgctattgctgatggg
tatagtactattactgaaaccatctttgaaaatagatttatgcacattcctgaattatca
cgcatgggcgcaaatcttgttttaaaaggtaacactgttgtttgcaaaggggtaaaatat
ttaactggaatgcccttaatagcaactgatttaagggcttcagcatctttagtgttagct
ggattagtagcaacgggtaccacaacgattgaacgtgtttaccatctagatcgtggttat
gaaacaatcgaggaaaaattaaaactattaggtgctcaaattgaacgtgtacaggattaa

DBGET integrated database retrieval system