KEGG   Candidatus Vesicomyosocius okutanii (Calyptogena okutanii): COSY_0653Help
Entry
COSY_0653         CDS       T00530                                 

Gene name
cbbM
Definition
(GenBank) ribulose-bisphosphate carboxylase form II
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
vok  Candidatus Vesicomyosocius okutanii (Calyptogena okutanii)
Pathway
vok00630  Glyoxylate and dicarboxylate metabolism
vok01100  Metabolic pathways
vok01110  Biosynthesis of secondary metabolites
vok01120  Microbial metabolism in diverse environments
vok01130  Biosynthesis of antibiotics
vok01200  Carbon metabolism
Module
vok_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:vok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    COSY_0653 (cbbM)
Enzymes [BR:vok01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     COSY_0653 (cbbM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: BAF61766
UniProt: A5CWB0
Position
complement(681254..682636)
Genome map
AA seq 460 aa AA seqDB search
MDQSNRYADLSLDEDTLLAEGGHILVAYTMNIMPNFGGYLETAAHFAAESSTGTNVEVST
TDDFTKDLDAMVYEIDEVKGIMKIAYPCGLFDRNLIDGRAMVVSFLTLAIGNNQGMGDVK
CAQMIDFHVPKQMLDIFDGPSVDITDLWNLLGRDRKNGGYIAGTIIKPKLGLRPQPFAEA
AYQFWLGGDFIKNDEPQGNQVYARMKDVMPLVSDAMKRAQDETGEAKIFSANITADDYHE
MIARGEYILEAFGENAHHVAFLVDGYVGGCGMVTTARRNFPGQYLHYHRAGHGAITSPSS
VRGYTALVLAKLSRLMGASGIHVGTMGYGKMEGGADDRNIAYMIERDSADGPVYHQEWFG
MKPTTPIISGGMNALRLPGFFENLGHGNVINTSGGGSYGHIDSPSAGAKSLRQAYDCWMA
KADPIEFARDNNEFARAFESFPGDADSLYPGWRDKLGVHK
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggatcaatcaaatagatatgcagatttgtcattagacgaagatacgctattagctgaa
ggcgggcatattcttgttgcctacacaatgaacataatgcctaattttggtggttattta
gaaactgctgctcactttgcagcggaatcatctactggtacaaatgttgaagtatcaact
acagatgattttactaaagatttagatgctatggtttatgagattgatgaagttaaaggt
attatgaagattgcctatccatgtggcttattcgatcgtaatttaattgacggtcgtgca
atggttgtatctttcctaacacttgccattggtaataaccaaggtatgggtgatgtgaaa
tgcgcgcaaatgattgatttccacgttcctaagcaaatgttagatatttttgacggtccc
tctgttgatattacagatttatggaatctattgggccgtgatcgtaaaaatggtggttat
atcgctggtacgattattaagcctaagttgggattacgtcctcagccttttgctgaagca
gcatatcaattctggttaggtggtgactttattaagaatgatgaacctcaaggtaaccaa
gtttatgcacgtatgaaggatgtaatgcctttagtttctgatgctatgaagcgtgcacaa
gacgaaacgggtgaagctaaaattttctctgctaatattactgctgatgactatcatgaa
atgattgctcgtggtgaatatattttagaagcatttggcgagaatgcgcatcatgttgct
tttttagttgatggttatgtgggtggttgtggtatggttactactgcacgtcgtaacttc
cccggtcagtacctacattatcatagagctggtcatggtgcgattacatctccaagttca
gttcgtggttatacggcactggttcttgctaaactttctcgccttatgggtgcatctggt
attcatgtgggtacaatgggttatggtaagatggaaggtggtgctgatgatagaaacatt
gcatacatgattgagcgagatagcgctgatggtccagtttatcatcaagagtggtttggt
atgaagccaacaacaccaattatttctggtggtatgaatgcgttacgtcttcctggtttc
tttgaaaaccttggtcatggtaacgtaattaacacttctggtggtggttcttatggtcat
attgattcgccttcagcgggtgctaagtcattacgtcaagcatatgattgttggatggct
aaagctgatccaattgagtttgctagagataataatgaatttgctcgtgcatttgaatct
tttccaggggatgccgattctttatatcctggttggagagataaattaggcgttcacaag
taa

DBGET integrated database retrieval system