KEGG   Vibrio owensii: A9237_04570Help
Entry
A9237_04570       CDS       T04844                                 

Gene name
ushA
Definition
(GenBank) bifunctional metallophosphatase/5'-nucleotidase
  KO
K11751  5'-nucleotidase / UDP-sugar diphosphatase [EC:3.1.3.5 3.6.1.45]
Organism
vow  Vibrio owensii
Pathway
vow00230  Purine metabolism
vow00240  Pyrimidine metabolism
vow00760  Nicotinate and nicotinamide metabolism
vow01100  Metabolic pathways
vow01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vow00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A9237_04570 (ushA)
   00240 Pyrimidine metabolism
    A9237_04570 (ushA)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    A9237_04570 (ushA)
Enzymes [BR:vow01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     A9237_04570 (ushA)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.45  UDP-sugar diphosphatase
     A9237_04570 (ushA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos
Motif
Other DBs
NCBI-ProteinID: AQW57438
Position
1:complement(1052384..1054045)
Genome map
AA seq 553 aa AA seqDB search
MKQRLIVKTALSAAILATLAGCATQPAHEWNEDTTYKLTVLHTNDHHGRFWQNKYGEYGM
AARKTLIDELRAEIQAEGGSVLLLSGGDINTGVPESDLQDAEPDFKGMSKIGYDAMALGN
HEFDNPLEVLFKQQEWANFPMLSANIYDKETGERLFQPYAMFNKQGIKIAVIGLTTEDTA
KLGNPEYIGEVDFRDPKEEAKKLIAELKQTEKPDLIFAVTHMGHYENGNRGVNAPGDVAL
ARYLNEGDLDMIVGGHSQEPVCMEGPNVIKKNFKPGDECKPDEQNGTYIVQAYEWGKYVG
RADYEFRNGELSMVSYDLIPVNLKKKIKVNGESQRVLVQDEIAQDSAMLDFLRPYQEKGQ
GQLNVKIAESNGKLEGDRNVVRFQQTNLGRLIATAHMERAKADFAVMNSGGVRDSIEAGD
ITYKDVLTVQPFGNMVSYVDMSGKEVLDYLNVVATKPVDSGAYAQFAGITMTVENGKVSN
VFIGEKQLRLDGQYRFTVPSYNASGGDGYPKVNTHPGYVNTGFTDAEVLKEFLESHSPID
VNEYAPSGDIVYK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaacgcctgattgtaaaaaccgctttgagcgcagctatcttggcaactcttgcc
ggatgtgccacgcaaccagcacacgaatggaatgaagacacaacttacaaactgaccgta
ctgcacaccaatgaccaccacggtcgtttttggcaaaacaagtacggtgagtacggcatg
gcggcacgtaaaacgctgattgatgaactgcgtgcagagattcaagccgaaggcggtagc
gtgcttctactatcaggtggtgatatcaacactggtgttcctgagtctgacttacaagat
gctgagcctgacttcaaaggcatgagtaagattggttacgacgcaatggcgctggggaac
cacgagttcgataacccactggaagtactgttcaaacagcaagagtgggcaaacttccca
atgctgtctgccaatatttacgacaaagaaaccggcgagcgattgttccaaccttatgcc
atgttcaacaagcaaggcatcaagattgcggtgattggcctaacgacagaagacacggca
aaactgggtaacccagaatacatcggcgaggttgatttccgcgacccgaaagaagaagcg
aaaaagctgattgctgaactaaagcaaactgaaaagccagatcttatcttcgcagtgaca
cacatgggtcactacgaaaacggcaaccgtggtgtgaatgctcccggtgacgtggccttg
gctcgctacctaaatgaaggtgatttggacatgattgtgggtggtcactcacaagagcca
gtttgtatggaaggccctaacgtcattaagaagaactttaagccgggtgacgaatgtaag
ccagatgagcaaaacggtacttacattgtgcaagcgtacgagtggggtaagtacgttggt
cgtgctgattacgagttccgcaacggcgaattgtcgatggtgagctacgatctgattccg
gttaacttgaagaagaaaatcaaagtgaacggtgagtctcaacgtgtcttggttcaagat
gaaatcgcacaagactcagcaatgttggatttccttcgcccttaccaagaaaaaggtcag
ggtcagttgaatgtgaaaattgccgaatctaacggcaaattggaaggtgaccgcaacgtt
gttcgtttccaacaaactaaccttggtcgtttgattgcaacagctcacatggagcgcgct
aaagcggattttgctgtgatgaactcaggcggtgttcgtgattcgattgaagcaggcgac
atcacctacaaagacgtgctgacggttcagccatttggcaacatggtgtcttacgtcgat
atgtcgggtaaagaagtgctcgattacttaaacgtcgtagcgacaaagcctgttgactct
ggtgcttacgctcagtttgctggcattaccatgacggttgaaaatggcaaagtatcgaat
gtttttatcggtgaaaaacagcttcgcctagatggtcaataccgctttaccgtaccaagc
tacaacgcgtcaggtggtgatggttacccgaaagtgaatactcatccgggttacgtcaac
acgggctttacggatgctgaagtactgaaagaattcttggaatcacacagtccaattgat
gtaaatgagtacgcgccttctggtgacatcgtttacaagtaa

DBGET integrated database retrieval system