KEGG   Vibrio owensii: A9237_05950Help
Entry
A9237_05950       CDS       T04844                                 

Definition
(GenBank) aerobic respiration two-component sensor histidine kinase ArcB
  KO
K07648  two-component system, OmpR family, aerobic respiration control sensor histidine kinase ArcB [EC:2.7.13.3]
Organism
vow  Vibrio owensii
Pathway
vow02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vow00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A9237_05950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vow01001]
    A9237_05950
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vow02022]
    A9237_05950
Enzymes [BR:vow01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     A9237_05950
Protein kinases [BR:vow01001]
 Histidine kinases
  OmpR family
   A9237_05950
Two-component system [BR:vow02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   A9237_05950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HKR_ArcB_TM HATPase_c PAS_4 Response_reg PAS HisKA Hpt PAS_9 PAS_8 HATPase_c_3 Exonuc_VII_L CCB1 PAS_3 Atg14 DUF572
Motif
Other DBs
NCBI-ProteinID: AQW57677
Position
1:complement(1334899..1337259)
Genome map
AA seq 786 aa AA seqDB search
MKPMKNLAQYYVDLLVKLGIVRFSILLALALVALAVVVQVGITLALKGNVDDIDIVRSVF
FGLLITPWAVYFLSVVVDQLEESRQRLTKLVSKLKDMRSRDQELNFQLQQNIEKLNQEIE
ERIKAEEAREEAMQDLENEVFQRERTQLELAERTALLRSFIDASPDLIYYRNADGVFSGC
NRAMEELTGKKEHQLVGLSPWDVYSKEVAEHIVDTDQKVFADNQAITYEQWLEYPDGRKH
YFELRKVPFYSKDGRHLGLVGFGRDITERKRHEESLEKASRDKTTFISTISHELRTPLNG
IVGLSRMLLDSQLTDEQRKHMQTINVSAITLGNIFNDIIDMDKFDRRKLELLPAPLNFED
FVAEIESISALMAEQKGLRFDLERLSSLPKAIEVDATRLRQVIWNLVSNAMKFTKEGGVV
MTVSADVEEDYATIIMEVEDTGIGIPDEELDKIFAMYYQVKSGKDNLHAVGTGIGLAVSK
QLINMMDGDITVASEEGFGSTFTVSIHVPIVELEEPIIDAKRDKVHLNIFMVEDIELNVT
VAKSLLESLGHTVTVAMTGEEALVNFVPDEYDLALLDIQLPDMTGFDVAKYYREHYDNLP
PLVALTANVMKDRREYLDNGMDDAISKPLAVQAMQAVIDKFFVERIESEQEVVAEPEVIE
EVAPTPSPVLNTHLLDLDMLESYVDIVGVKPVYDSIKMFEDMMPDYIEVLDSNMTAKDQD
GIVSEAHKIKGAAGSIGLKHIQSVAQKAQSPDMPAWWENISDWVEEIKNEYQNDIQVLKS
WLEQRK
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccatgaaaaatctcgcccagtattacgttgaccttttggttaagctggggatt
gtccgtttctcgatattactggcacttgcgctggtcgccttagctgtcgtggtgcaagtg
ggtattaccctcgcgctcaaaggtaatgtcgatgacatcgatatcgttcgttcggtattc
tttggtcttcttattacgccgtgggccgtttacttcttatcagtggttgtcgatcaacta
gaagaatcacgtcaaaggttgacgaagttagtctccaaactgaaagacatgcgctcgcgt
gaccaagagttgaactttcaactgcaacagaacattgaaaagctcaaccaagagattgaa
gagcgtattaaagcggaagaagctcgtgaagaagcgatgcaagacctcgagaatgaagtc
tttcaacgcgaacgcactcagctagagcttgctgagcgtaccgcactattacgttctttt
attgatgcctctccagaccttatttactaccgcaatgccgatggtgttttctctggctgt
aaccgtgcgatggaagagctaaccggtaagaaagaacatcaattggtggggttaagcccg
tgggatgtctacagtaaagaagtagcggagcatatcgtcgatactgaccaaaaagtcttt
gccgacaatcaagcgattacttacgagcaatggctggaatacccagatggacgtaagcat
tactttgaactgcgtaaggtgccgttttacagcaaagatggccgccaccttggtctagtg
ggcttcggtcgtgatatcactgagcgtaaacgccatgaagagtctctagaaaaagccagc
cgagataaaaccacgtttatttctacaatcagtcatgagcttcgtacgccattaaacggc
atcgttggtctgagccgtatgttgcttgatagccaactgacggacgagcagcgcaagcac
atgcaaactatcaacgtcagtgccattactttgggcaacatcttcaacgacatcatcgat
atggacaaattcgaccgtcgtaaattggagctgttgcctgcgccgttgaactttgaagac
ttcgtcgctgaaatcgaaagcatctcagcactgatggcagagcaaaaagggctgcgcttt
gacctagagcgtttaagttcattgcctaaagcgattgaagtcgatgccacacgtctgcgt
caggtcatttggaaccttgtcagcaacgccatgaagttcaccaaagaaggtggtgtggtg
atgacggtgagcgccgatgttgaagaagattacgcgaccatcattatggaagtggaagac
accggtattggtattccagacgaagagctcgataagatctttgcgatgtactaccaagtg
aaatcaggcaaagacaacttacatgcggttggtacaggcattggtttagcggtatctaag
caactgatcaatatgatggatggtgacattacggtagcaagtgaagaaggctttggtagt
acctttaccgtatcgattcatgtacctatcgttgagttagaagagccaattatcgatgct
aagcgcgataaagtgcacctcaacatctttatggtcgaagacatcgaacttaacgtgact
gttgctaagtccttacttgagagcttaggtcacaccgttaccgtagcaatgaccggtgaa
gaagcactagtgaactttgtgcctgatgaatatgacttagcactgctagacatccaattg
ccagacatgacgggcttcgatgtggctaagtactaccgcgaacactacgacaacttacca
ccgctggtggcgctcactgcgaatgtgatgaaagatcgtcgtgagtacctagataacggc
atggacgatgccatcagcaagccacttgcagttcaagcaatgcaagccgtgattgataag
ttctttgttgaacgtattgagagtgagcaggaagtggttgcagaacctgaggtgattgaa
gaagtcgccccaacgccatcaccagtgctcaatacgcatttactcgatttagatatgctc
gaatcttacgtggatatcgtgggtgtgaagcctgtttacgatagcatcaagatgtttgaa
gacatgatgccagattacatcgaagtacttgattcaaatatgacggccaaagaccaagat
ggcattgtctctgaagcacacaaaatcaaaggtgccgcaggctcaattggtcttaaacac
attcagagcgttgcacagaaagcgcagtctccagatatgcccgcatggtgggagaacata
tcagattgggtagaagaaattaaaaacgagtatcaaaacgatatacaagtattaaaaagt
tggttggaacagaggaaataa

DBGET integrated database retrieval system