KEGG   Vibrio owensii: A9237_06555Help
Entry
A9237_06555       CDS       T04844                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
vow  Vibrio owensii
Brite
KEGG Orthology (KO) [BR:vow00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    A9237_06555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AQW57792
UniProt: A0A3G2QDF4
Position
1:1485621..1486001
Genome map
AA seq 126 aa AA seqDB search
MDVIQPCIKIQVHTKYIEEQSNPELQRYVFAYIITIKNLSQQTVQLVSRRWLITDSNGKQ
MTVEGEGVVGQQPFIPGNDEYTYSSGTALETPVGVMQGHYMLLDEKGQQFITEIDPFRLA
VPNVLN
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcattcaaccttgcatcaaaatccaagttcataccaaatacattgaagaacag
tccaacccagaactgcagcgatacgtcttcgcttatatcatcacaataaaaaacctcagc
caacaaactgttcaattagttagccgtcgctggttaatcaccgattcaaacggtaaacaa
atgacggtcgaaggtgaaggcgttgttggtcaacagccttttattccgggtaacgacgaa
tacacttacagcagcggaacagcgcttgaaacaccggttggtgttatgcaaggacactac
atgttgttggatgaaaaaggacagcaatttatcaccgagattgatccattccgtttagcg
gttccaaacgtcttaaattaa

DBGET integrated database retrieval system