KEGG   Vibrio owensii: A9237_13660Help
Entry
A9237_13660       CDS       T04844                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
vow  Vibrio owensii
Pathway
vow00430  Taurine and hypotaurine metabolism
vow00620  Pyruvate metabolism
vow00640  Propanoate metabolism
vow00680  Methane metabolism
vow01100  Metabolic pathways
vow01120  Microbial metabolism in diverse environments
vow01200  Carbon metabolism
Module
vow_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:vow00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9237_13660
   00640 Propanoate metabolism
    A9237_13660
  09102 Energy metabolism
   00680 Methane metabolism
    A9237_13660
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    A9237_13660
Enzymes [BR:vow01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     A9237_13660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase UBA_2
Motif
Other DBs
NCBI-ProteinID: AQW59039
Position
1:complement(2962577..2963773)
Genome map
AA seq 398 aa AA seqDB search
MSKLVLVLNCGSSSLKFAVVDAETGAEHLSGLAECLHLPEARIKWKLDGKHEAQLGNGAA
HEEALAFMVETILASKPELKANLGAIGHRIVHGGEQFTQSALITDDVLKGIQDAATFAPL
HNPAHIIGIEAAKHNFPELQNVAVFDTAFHQTMPEESFLYALPYKLYKEHGIRRYGMHGT
SHLFITREVAGLLNKPVEEVNIINCHLGNGASVCAIKNGKSVDTSMGLTPLEGLVMGTRC
GDIDPAIVFHLHDALGYSVEEINNMLTKESGLAGLTEVTSDCRFVEDNYGEKEEATRAMD
VFCHRLAKYVAGYTASMEGRLDAITFTGGIGENSGPIREMVLNRLGIFGIEVDGEANLKA
RFGGEGTITTANSRIPAMVISTNEELVIAEDTARLAGL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagctagttttagttttaaactgcggtagttcttctcttaaatttgctgttgtt
gatgcagaaacaggtgcagagcacctatcaggtcttgctgaatgtcttcaccttcctgaa
gcacgtatcaagtggaaacttgacggtaaacacgaagctcaactaggtaacggtgcagca
cacgaagaagcactagcgttcatggttgaaactattcttgcttctaagccagagcttaaa
gctaacctaggcgctatcggtcaccgtatcgtacacggtggtgagcagttcactcaatct
gcactaatcactgatgacgtactaaaaggtattcaagacgctgcgactttcgcaccgctt
cacaacccagcgcacatcatcggtatcgaagctgctaagcataacttcccagagcttcaa
aacgttgctgtattcgacactgcgttccaccaaactatgcctgaagagtctttcctatac
gctcttccatacaaactatacaaagagcacggtatccgtcgttacggcatgcacggtact
tcacacctattcatcactcgtgaagttgcaggcctactaaacaagccagttgaagaagta
aacatcatcaactgtcacctaggtaacggtgcttctgtttgtgcaatcaagaacggtaaa
tctgttgacacttctatgggtcttactcctcttgaaggtctagtaatgggtactcgttgt
ggtgatatcgacccagctatcgtattccacctacacgacgctctaggttactctgttgaa
gaaatcaacaacatgctaactaaagagtctggtcttgctggtctaactgaagtgacttct
gactgtcgtttcgttgaagacaactacggtgagaaagaagaagcaactcgtgcaatggac
gtgttctgtcaccgtctagctaagtacgtagctggttacactgcttctatggaaggtcgt
ctagacgcaatcactttcactggcggtatcggcgaaaactctggccctatccgtgaaatg
gttctaaaccgtctaggtatcttcggtatcgaagttgatggtgaagctaaccttaaagca
cgtttcggcggcgaaggtactatcactacagctaacagccgtatcccagcaatggttatc
tctactaacgaagagctagtaattgctgaagacactgcacgcctagcaggtctttaa

DBGET integrated database retrieval system