KEGG   Vibrio owensii: A9237_16665Help
Entry
A9237_16665       CDS       T04844                                 

Definition
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
vow  Vibrio owensii
Pathway
vow00730  Thiamine metabolism
vow01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vow00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    A9237_16665
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vow03000]
    A9237_16665
Enzymes [BR:vow01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     A9237_16665
Transcription factors [BR:vow03000]
 Prokaryotic Type
  Other transcription factors
   Others
    A9237_16665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AQW59700
Position
2:complement(19960..20628)
Genome map
AA seq 222 aa AA seqDB search
MKYQDLIDACRQDWQEYTEHAFVQQLAQGTLAQPCFLHYLKQDFLFLKQYARAYALAIYK
ARTLDDMRRALPSVHALLDSEIAHHVTYCEQWGLTESDLENEPEDFGTVAYTRYVLDAGM
TGDLVDLYAALAPCSIGYAVIGKMLIESENTVIEGNPYASWINLYGGEEFQSGVAKGAEH
FNQLLAEIDINSQRGQNLIQVFKTATRMEVAFWQQGLNAQQD
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaaataccaagatttgatcgacgcttgccgccaagattggcaagaatacactgagcat
gctttcgtgcagcaattggcacaaggcactctggctcagccttgttttctgcattaccta
aagcaggattttcttttcctaaaacagtacgcacgagcttacgcattagcgatctacaaa
gcacgtactttggatgacatgcgccgtgccctaccaagcgtacatgcattgctagattct
gaaatcgcccaccacgtgacttactgtgagcaatggggactgacagaatccgacttagaa
aacgagccagaagatttcggcactgtggcttacacccgctacgtattggatgctggcatg
acgggcgatcttgttgatctatacgcggcactagcaccatgctctatcggttatgccgta
atcggtaagatgctgattgaaagtgagaacacggtaatcgaaggcaatccatacgcaagt
tggatcaacctctacggtggtgaggaattccaatctggtgtcgcaaaaggtgcagaacac
tttaatcagttattggcggaaatcgatatcaatagccagcgtggtcaaaacctgattcag
gtattcaaaactgcaacgcgtatggaagtggcattctggcaacaaggcctgaacgctcag
caagattaa

DBGET integrated database retrieval system