KEGG   Vibrio owensii: A9237_16990Help
Entry
A9237_16990       CDS       T04844                                 

Definition
(GenBank) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
vow  Vibrio owensii
Pathway
vow00310  Lysine degradation
vow01100  Metabolic pathways
vow01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vow00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    A9237_16990
Enzymes [BR:vow01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     A9237_16990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo Pyr_redox_2 NAD_binding_8 FAD_binding_3 TrkA_N NAD_binding_9 Trp_halogenase FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AQW59751
Position
2:87440..88666
Genome map
AA seq 408 aa AA seqDB search
MKSVYDYIIVGGGIVGVSTAWQLQQRHPNKSILLVEKESGFAKHQTGHNSGVIHAGVYYA
PGSLKADFCKRGVERTISFCAEHDIPVENCGKLLVATNEQEVERMNALYERCHVNGIDVK
LLDEVQLKLAEPNITGLGAIYVKTTSIVDYRLVTEQMAEEFKKLGGQISLRTKVVAAEEK
DEEVQLTCISDGQTMQLNAKFLVTCSGLMADRMTKMMSIPTDFQIIPYRGEYYRLDSKHD
QVVNHLIYPIPDPDLPFLGVHLTRMIDGSVTVGPNAVQGWKREGYDKVNFSLQDTMQMLS
FSGFWKVTQKHLKTGLDEFKNSWWKPGYLKLVNKYCPSIKVDDLKPYPAGIRAQAVLSDG
TLVHDFLFAESARSLHVCNAPSPAATSAMPIGEYICDKVNEKIEAKTV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagtctatgactacatcattgttggtggcggtatcgttggtgtgtcgacggca
tggcagctgcagcaacgtcacccaaacaaatccattttattggttgagaaagagtccggt
tttgccaagcatcaaaccggacacaacagcggtgtgattcatgccggggtgtactacgca
ccgggcagcttaaaagccgatttttgtaagcgtggggtagagcgaaccatttcgttctgt
gccgagcacgatattccggtggagaactgtggcaagttactggttgcgaccaatgagcaa
gaagtcgaacgcatgaatgccctctatgagcgctgccatgtcaacggcatcgacgtaaag
ctactcgatgaagttcaactcaagctggctgagccaaacatcacgggcttgggcgcgatt
tatgtcaaaaccaccagtattgtcgattatcgtttggtcacggagcagatggcggaagag
ttcaaaaagctcggcggtcaaatcagtctgagaaccaaagtggtggctgccgaagagaaa
gacgaagaagttcaattgacctgcatttcagacgggcaaaccatgcagctcaatgccaaa
ttcttggtcacttgcagcggcttgatggcggatcgcatgacgaagatgatgtctattcca
accgatttccaaatcatcccttatcgtggtgaatactaccgtttagatagcaaacacgac
caagtggtgaaccatcttatttatccaattccagaccctgatttgccattcttgggtgtc
cacctaactcgcatgattgatggcagtgtgaccgttggtccaaatgcggtgcaaggctgg
aagcgagaagggtacgacaaggttaatttcagcttgcaagataccatgcaaatgctcagt
ttctccggcttttggaaggtgacacaaaagcatctaaaaaccggattggatgagtttaag
aactcgtggtggaagccgggctatctcaagttggtcaacaaatattgcccaagcatcaag
gtcgacgatctcaaaccatatcccgcgggtattcgtgcgcaagcagtgttatccgatggc
actttagttcatgacttcttgtttgccgagagcgcaagaagcctacacgtttgcaacgca
ccctcacccgcagcgacatctgcaatgccgattggggaatacatttgcgataaagtgaat
gagaagatagaagcgaaaacggtataa

DBGET integrated database retrieval system