KEGG   Vibrio owensii: A9237_19660Help
Entry
A9237_19660       CDS       T04844                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vow  Vibrio owensii
Pathway
vow00071  Fatty acid degradation
vow00072  Synthesis and degradation of ketone bodies
vow00280  Valine, leucine and isoleucine degradation
vow00310  Lysine degradation
vow00362  Benzoate degradation
vow00380  Tryptophan metabolism
vow00620  Pyruvate metabolism
vow00630  Glyoxylate and dicarboxylate metabolism
vow00640  Propanoate metabolism
vow00650  Butanoate metabolism
vow00900  Terpenoid backbone biosynthesis
vow01100  Metabolic pathways
vow01110  Biosynthesis of secondary metabolites
vow01120  Microbial metabolism in diverse environments
vow01130  Biosynthesis of antibiotics
vow01200  Carbon metabolism
vow01212  Fatty acid metabolism
vow02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vow00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9237_19660
   00630 Glyoxylate and dicarboxylate metabolism
    A9237_19660
   00640 Propanoate metabolism
    A9237_19660
   00650 Butanoate metabolism
    A9237_19660
  Lipid metabolism
   00071 Fatty acid degradation
    A9237_19660
   00072 Synthesis and degradation of ketone bodies
    A9237_19660
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A9237_19660
   00310 Lysine degradation
    A9237_19660
   00380 Tryptophan metabolism
    A9237_19660
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A9237_19660
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A9237_19660
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A9237_19660
Enzymes [BR:vow01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A9237_19660
Exosome [BR:vow04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A9237_19660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AQW60253
Position
2:697323..698534
Genome map
AA seq 403 aa AA seqDB search
MGNDIWIVSAKRTPIGRFQGQLQGYSAPQLGAFAIKAAMDASGVNEVDEVYMGCVLSAGC
GQAPARQAALGADLPLTTGCTTVNKVCGSGMKSVMLAHDLIKAGSIRSAVAGGMESMTNA
PYLLKEVRNGMRMGHQSTHDHMFLDGLQDAYEGHLMGVYAQQTADRSEFTREQMDEWAIL
SATRALEAQEQYLFNDEISPIEITTRHGASTLDYDEHPRSIKLDKIPQLKPAFDKNGSVT
AANSSAISDGAAALVLIDSQVAQHQGLTPLAIIKGHSTHARKPTEFTLAPVFAIEQLLSQ
LDWSVDEVDLWEINEAFAVVTQIAVRQLGIDKDKVNIKGGACALGHPIGASGARILVTLI
HSLRQLQSLGLDGDNNNKKVMRGVASLCIGGGEATAIGIEIPL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgacatctggattgtcagtgcaaagcgaacgccaatcgggcgctttcaaggt
cagttacaaggttattcagcgcctcaattaggggcatttgctatcaaagcggcaatggat
gcgagcggcgttaacgaagtcgacgaagtctacatgggctgcgtattatctgcggggtgc
ggacaagcaccagccagacaagcagcgctaggtgcagatcttccactgacgacaggctgt
accactgtcaataaagtgtgtggctctggcatgaaaagcgtcatgttagctcacgatctt
atcaaagcgggcagcattcgcagtgccgtcgctggtggtatggaaagcatgaccaatgcg
ccgtatctgcttaaagaagtgcgtaacggcatgcgaatgggtcaccaatctactcacgac
catatgtttctcgacggtcttcaagatgcgtatgaagggcatttgatgggagtctatgcg
cagcagacggctgaccgttcggagtttactcgtgaacaaatggatgaatgggcaatccta
tctgcgacaagagcgttggaagcgcaagagcagtatctgtttaacgatgaaatctcaccg
atagaaatcacgactcgccatggcgcttcaacattggattacgacgagcatcctcgctcc
atcaagctcgacaagatccctcaactcaaacccgcgttcgataaaaacggctcggtgacg
gcagcaaactcaagtgcgatatccgatggtgctgcagccttggtgttaatagactcgcag
gtggcacagcatcaaggtttaacgccattagcaatcatcaaagggcactcgacccacgcc
agaaagcccaccgaatttaccctcgcgcccgtctttgcaatagagcagttgttatctcaa
ctcgattggtcagtggacgaggtcgatctttgggagatcaacgaagctttcgccgttgtc
acgcaaatcgcggtacgccagttaggcatcgataaagacaaagtaaacatcaaaggcggt
gcgtgtgcgcttgggcatccaattggcgcaagtggagctcgtattttagtgaccctcatt
catagcctgcgccaactgcaatcgcttggtttagatggcgacaacaacaataaaaaggtg
atgcgaggtgttgcatcactgtgtatcggtggtggtgaagccactgctattggtatcgag
ataccgctttaa

DBGET integrated database retrieval system