KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0418Help
Entry
VP0418            CDS       T00120                                 

Definition
(RefSeq) pho4 family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    VP0418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-GeneID: 1187886
NCBI-ProteinID: NP_796797
UniProt: Q87SK5
Position
I:complement(417899..419158)
Genome map
AA seq 419 aa AA seqDB search
MDILANYGTVLIIVAAIFGFMMAIGIGANDVANAMGTSVGSKALTVKQAIIIAMIFEFAG
AYLAGGEVTDTIRKGVIETSLFASQPDILVFGMMSALLAAGTWLLLASYMGWPVSTTHSI
IGAIIGFACVSVGTEAVDWSSVQGIVGSWIITPVISGFFAYVIFVSAQRLIFDTENPLFN
AKRFVPVYMFITTMVIALVTIKKGLKHVGLHLTNGEAWMWAVAVSALVMAGGYFYIQKKF
ANREEDRSFAGVEGIFSVLMVITACAMAFAHGSNDVANAIGPLSAVVSTVEHMGEVTAKS
TIAWWILPLGGIGIVVGLATMGHKVMATVGTGITELTPSRGFAAQLATACTVVLASGTGL
PISTTQTLVGAVLGVGFARGIAALNLGVVRNIVASWIVTLPAGALLAVVFFYGIQAMFS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggatatccttgcgaactacggcactgtcctgattattgttgcagcgatttttggtttc
atgatggcgattggtattggcgcgaacgacgttgctaatgcgatgggtacatcagtaggt
tcaaaagcgctaaccgtaaaacaagctatcatcattgcgatgatcttcgaatttgcgggt
gcataccttgcaggcggtgaagtaaccgacactatccgtaaaggtgttatcgaaacatct
ctctttgctagccaaccagacattcttgtcttcggtatgatgtcagcacttcttgctgct
ggtacatggctactgcttgcttcttacatgggctggcctgtatcaacgactcactctatc
atcggtgcaatcatcggttttgcgtgtgtgtctgtcggtactgaagcggttgactggagc
agcgttcaagggattgtcggtagctggatcattactccggttatctcaggcttctttgct
tacgtcattttcgtcagcgcacagcgtctgatttttgatactgagaacccactattcaac
gcaaaacgttttgttcctgtttacatgttcatcacgacaatggtgattgcacttgtaacc
atcaaaaaaggtctgaagcacgttggtcttcacctgactaacggcgaagcgtggatgtgg
gcagtagcggtatctgcacttgttatggctggcggctacttctacattcagaaaaaattc
gctaaccgtgaagaagaccgcagctttgctggcgtagaaggtatcttcagcgttctaatg
gtaatcacagcttgtgcgatggcatttgctcacggctcaaacgacgtagcaaacgcaatt
ggccctctttctgcagtagtatcgactgttgaacatatgggtgaggttacagcgaaaagc
actatcgcatggtggattcttccattgggcggtatcggtattgttgtcggtcttgcaaca
atgggccacaaagtaatggcaaccgttggtacaggcatcactgaactaacaccaagccgt
ggttttgctgctcagcttgcaactgcatgtacggttgtattggcatcaggtactggtctg
ccaatctctaccactcaaacactggttggtgcggttctaggtgtaggttttgcacgtggt
atcgcggcgctaaacttaggtgtagtacgtaacatcgtggcttcatggattgttacgcta
ccagcaggtgcactattggctgtcgtattcttctacggcattcaagcgatgttctcttaa

DBGET integrated database retrieval system