KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0496Help
Entry
VP0496            CDS       T00120                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00260  Glycine, serine and threonine metabolism
vpa00750  Vitamin B6 metabolism
vpa01100  Metabolic pathways
vpa01110  Biosynthesis of secondary metabolites
vpa01120  Microbial metabolism in diverse environments
vpa01230  Biosynthesis of amino acids
Module
vpa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VP0496
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VP0496
Enzymes [BR:vpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VP0496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-GeneID: 1187964
NCBI-ProteinID: NP_796875
UniProt: Q87SC8
Position
I:511966..513246
Genome map
AA seq 426 aa AA seqDB search
MKLYNIKENDEQVSFGQAVRQGLGRNQGLFFPSELPKFEDVDALLAEDFVSRSTKILSAL
IGDELAEEQVNAMVDAAFQFPAPINQVKEGVYALELFHGPTLAFKDFGGRFMAQSLAAVS
NGGKITILTATSGDTGAAVAHAFYGMEDINVVILYPKGKISPLQEKLFCTLGKNIHTVAI
NGDFDACQALVKQAFDDAELREEIGLNSANSINISRLMAQICYYFEAAAQMSKQERENLV
VSVPSGNFGNLTAGLLAKALGLPIKRFIAATNANDTVPRYLETGKWEPKPTVATTSNAMD
VSQPNNWPRIEELCRVKEWGLETLGKGAVSDEQSAQSVKDLYALGYLCEPHGAIAYRVLE
EQLQEGETGLFLCTAHPAKFKEVVDDILQTDIELPAPLAKHAAMELLSEDLDADFDALKT
VLRRVQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttacaatataaaagaaaatgatgaacaagtttcctttggtcaagccgttcgc
caaggattaggtcgtaatcaaggcctatttttcccatcggaattaccaaaatttgaagat
gttgatgcgttgttagcagaagattttgtctctcgtagcactaagattctatcagcactg
attggtgatgaactggcggaagagcaagttaacgcaatggttgatgcagcattccaattc
ccagcaccaatcaaccaagtaaaagaaggcgtttacgcgctagaacttttccatggcccg
acgttagcatttaaagatttcggtggccgcttcatggcgcaatcccttgcggcagtttct
aatggcggcaagatcaccattttgaccgcaacgtcaggcgatactggcgcagctgttgcg
catgctttctacggaatggaagacattaatgttgtgattctttacccgaaaggcaagatc
agcccgctccaagagaagctgttttgtacactaggtaaaaacatccacactgtagcaatc
aatggtgatttcgatgcatgtcaagcattggtgaaacaagcgtttgatgatgcggagctg
cgtgaagagatcggtctgaactctgcaaactcaatcaacatcagccgcttgatggcacaa
atctgttactactttgaagctgcggcgcaaatgagtaagcaagagcgtgaaaacctcgtg
gtttctgtaccaagcggtaactttggtaacctaacagcaggtctattagcaaaagcgcta
ggtttacctatcaaacgttttattgctgctaccaacgcgaatgacacggtgcctcgttac
ctcgaaacgggcaaatgggagccaaaaccaacggttgcaaccacttcaaatgcgatggac
gtgagccaaccgaacaactggccgcgtatcgaagagctgtgccgtgtgaaagagtggggc
ctagagacactaggtaaaggcgcagtttctgatgaacaaagcgcacaatcagtaaaagac
ttgtacgcattaggctacctatgtgagccacacggtgcgattgcttaccgcgtattggaa
gagcaactgcaagaaggtgaaacgggtctgttcttgtgtactgcgcaccctgcgaagttc
aaagaggttgtagatgatattcttcaaacggatatcgaattgcccgcaccactagctaaa
catgctgcgatggagttgttgtctgaagatcttgatgcggattttgatgcactaaaaaca
gtattacgtcgcgttcagtaa

DBGET integrated database retrieval system