KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0524Help
Entry
VP0524            CDS       T00120                                 

Gene name
thyA
Definition
(RefSeq) thymidylate synthase
  KO
K00560  thymidylate synthase [EC:2.1.1.45]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00240  Pyrimidine metabolism
vpa00670  One carbon pool by folate
vpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    VP0524 (thyA)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    VP0524 (thyA)
Enzymes [BR:vpa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     VP0524 (thyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylat_synt
Motif
Other DBs
NCBI-GeneID: 1187992
NCBI-ProteinID: NP_796903
UniProt: Q87SA0
Position
I:540798..541649
Genome map
AA seq 283 aa AA seqDB search
MKQYLDLCQRIVDQGVWVENERTGKRCLTVINADLTYDVANNQFPLVTTRKSFWKAAVAE
LLGYIRGYDNAEDFRKLGTKTWDANANLNDAWLNNPYRKGEDDMGRVYGVQGRAWAKPDG
GHIDQLRKIVDDLTRGVDDRGEILNFYNPGEFHMGCLRPCMYSHHFSLLDDTLYLNSTQR
SCDVPLGLNFNMVQVYVFLAIMAQITGKKPGQAFHKIVNAHIYEDQLELMRDVQLKREPL
QAPTFHINPEIKSLEDLETWVTLDDFWVEGYEHHDPIRYPFSV
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacagtatttagatttgtgtcaacgcatcgttgatcaaggtgtttgggttgaaaat
gaacgtacaggtaagcgttgcctgacggtaatcaacgcggatttaacctacgatgttgcg
aacaatcaattcccattggtaacgacgcgtaaaagtttttggaaagcagcagtggctgag
ctacttggctacattcgtggttatgataatgctgaagatttccgtaaattaggcaccaaa
acgtgggatgcgaacgccaacctaaacgacgcttggttgaataacccataccgtaagggt
gaagacgacatgggccgtgtgtacggcgttcaaggtcgtgcatgggcaaagcctgatggt
ggtcatatcgaccagctacgcaagattgtggatgatttgactcgcggtgttgatgaccgt
ggtgaaatcttgaacttctacaaccctggtgagttccatatggggtgcttgcgaccttgt
atgtacagtcatcatttctcactactggatgacactttgtatctcaacagtacacagcgt
tcgtgcgatgtgccgcttggattgaacttcaacatggttcaagtttatgtgttcttagcg
atcatggcgcaaattacgggcaagaagccaggccaggcattccataaaatcgttaacgcg
cacatttatgaagatcagcttgagttgatgcgtgatgttcagttgaagcgtgaaccgtta
caagccccaacattccatatcaatccggagattaaatctctagaagatttggaaacttgg
gtgacactggatgacttttgggtagaagggtacgaacaccacgatccaattcgttatcca
ttctcagtgtaa

DBGET integrated database retrieval system