KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0545Help
Entry
VP0545            CDS       T00120                                 

Definition
(RefSeq) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00520  Amino sugar and nucleotide sugar metabolism
vpa01100  Metabolic pathways
vpa01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VP0545
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    VP0545
Enzymes [BR:vpa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VP0545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-GeneID: 1188013
NCBI-ProteinID: NP_796924
UniProt: Q87S79
Position
I:562039..563022
Genome map
AA seq 327 aa AA seqDB search
MGPLWVDVAGYELTAEDKEILEHPTVGGLILFTRNYHDSEQLQALTQSIRKAVKRPFLIG
VDQEGGRVQRFREGFSLIPAADEYAKHHNGEELARMGGWLMAAELIAHDIDLSFAPVLDK
GHQCKAIGNRSFGEDADTILRYSTAYMQGMKSVGMATTGKHFPGHGGVIADSHLETPYDE
RSDIFEQDMAIFKAQIDAGILDAMMPAHVIFPNYDSQPASGSEYWLKHVLRQKLGFKGLI
FSDDLTMEGAAIMGSPAERGAQAMKAGCDMLLMCNKREAQVEVLDNLPVSTVPLADALLK
KQSFSLSDLKLSHEWKAASEAMKRLTS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgttatgggttgacgttgcgggttatgaactgaccgcagaagacaaagaaatt
ctggaacatcctacggttggtggcttgatcctatttactcgtaactatcatgatagtgaa
cagcttcaagcacttactcaatctatccgcaaagctgtgaaacgcccattcctgattggt
gtggatcaagagggcgggcgagtacaacgctttcgtgaaggtttctcgttaatccctgcc
gccgacgaatacgccaaacatcacaatggcgaagagctagcacgtatgggcggttggcta
atggcagccgagttgattgctcacgacatcgatttaagctttgcacccgtgctcgacaaa
ggtcatcaatgcaaagcgatcggtaaccgttcatttggtgaagatgccgataccatcctt
cgttatagcaccgcttatatgcagggtatgaagagcgtaggaatggcgacgaccggaaaa
cacttcccgggtcatggtggtgtgattgctgactcacatttagaaacgccatacgacgag
cgcagcgatatttttgaacaagacatggctatcttcaaagcgcaaattgatgccggtatt
ttagatgccatgatgcctgctcacgtgattttcccgaactacgattctcagcccgcaagt
ggttctgaatactggttgaaacacgttttacgtcaaaagcttggttttaaaggcttaatt
ttctccgatgatttgacgatggaaggcgctgcgatcatgggaagccccgctgagcgtggg
gctcaagccatgaaagccggttgcgatatgctattgatgtgtaataagcgtgaagcacaa
gttgaagtgttggataacttgcctgtttcaaccgtgccactggcggatgcgctactcaaa
aaacagtcgttttctttaagcgatctcaaattgtctcatgagtggaaagcggcgagtgaa
gcgatgaaacgcttgaccagctaa

DBGET integrated database retrieval system