KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0708Help
Entry
VP0708            CDS       T00120                                 

Definition
(RefSeq) D,D-heptose 1,7-bisphosphate phosphatase
  KO
K03273  D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC:3.1.3.82 3.1.3.83]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00540  Lipopolysaccharide biosynthesis
vpa01100  Metabolic pathways
Module
vpa_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    VP0708
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:vpa01005]
    VP0708
Enzymes [BR:vpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.82  D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
     VP0708
    3.1.3.83  D-glycero-alpha-D-manno-heptose 1,7-bisphosphate 7-phosphatase
     VP0708
Lipopolysaccharide biosynthesis proteins [BR:vpa01005]
 Unusual sugar
  VP0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like HAD_2 PNK3P Hydrolase Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 1188183
NCBI-ProteinID: NP_797087
UniProt: Q87RR9
Position
I:741295..741846
Genome map
AA seq 183 aa AA seqDB search
MAKPAVFIDRDGVINVDHGYVHDEHDFEYIDGVFEATKALKDKGYLLVLVTNQSGIARGK
FSEDRFLSLTQWMDWNFVDNGVEFDGFYYCPHHPEHGIGDYKQDCDCRKPKPGMFISARD
FLKIDMEKSVMIGDKAEDMMAAEAAGVGTKILVRTGKPITEQGEALATVVLDSIADVPAY
LQK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaaacctgctgtttttatcgatcgtgacggcgtgatcaacgttgaccacggctac
gttcatgacgaacatgattttgagtacattgacggtgtgtttgaagcgacaaaagcgctg
aaagataaaggttacctgttggtgcttgtaacgaatcaatcgggcatcgcgcgcggtaaa
ttcagtgaagaccgtttcttgtctctgacacaatggatggactggaacttcgttgataat
ggcgttgagtttgatggtttttactactgtccacatcatcctgagcatggcatcggtgac
tacaagcaagattgtgattgccgcaaacctaaacctggtatgtttatctctgctcgcgac
ttcttgaaaatcgacatggaaaaatctgtgatgattggtgataaagccgaagacatgatg
gcagcagaagccgcaggtgttggcactaagattctggttcgcacaggtaagccaatcacc
gagcaaggtgaagcattagctacagtagtgctcgatagcatcgcagatgtgccagcgtat
ttacaaaaataa

DBGET integrated database retrieval system