KEGG   Vibrio parahaemolyticus RIMD 2210633: VP1163Help
Entry
VP1163            CDS       T00120                                 

Definition
(RefSeq) alpha-1,6-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00052  Galactose metabolism
vpa00561  Glycerolipid metabolism
vpa00600  Sphingolipid metabolism
vpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VP1163
  Lipid metabolism
   00561 Glycerolipid metabolism
    VP1163
   00600 Sphingolipid metabolism
    VP1163
Enzymes [BR:vpa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     VP1163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_31 Raffinose_syn GHL6 Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 1188668
NCBI-ProteinID: NP_797542
UniProt: Q87QI6
Position
I:1219738..1221477
Genome map
AA seq 579 aa AA seqDB search
MAQTIQLANHSEMTIIDNDLHVDVIGNQAHFSFSGLHNKTFTDREVLFEMPFLYEHEANV
IGDGFQMLAQTSGTITHPIEIGRCPDNIPPYRVYSQHAPKRYYNYLVIEDSAGYTLFGFT
TCRRFAGYFDIQQRNGQWILTAAIDGEHTQVADWEHNQLESITILTGNSLSDLYQEFSEM
IAVHHPIRNGVTQDAPIGWCSWYAYYADVTEQNVLENVDCMQDKLEDLEWVLLDDGYQAF
MGDWLTPSDKFSGGVKELIQNIRAKGKKPAIWMAPFIAQPESEVFKQHPEWFVRHPDGQL
LKAEDVTYGGWRCTPWYILDTSNPEVQDHLTHVVSVMRLEWGVELFKLDANYWGTLKGKR
SQSGITGVEAYRLGMEAIARGAGDAWLLGCNAPMWPSLGLVDAMRVSDDVERHSHRFEQI
AKETFFRSWQHRKLWQIDPDCATFTSLANQAASREDYEFHRTVLLASGGLLLSGDPLPEI
TPFASKTLAKLMLRQRRSQESAKFTALSLSHAFLKLTDKNDLHCLFNYANHNATEFTLTA
DQPVDWYDYWTGEKLNQDPCQLLLVSVDRGLNAKAIVTA
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggctcagaccattcagttagccaaccattccgaaatgacgatcatcgataacgatctg
cacgtggatgtgattggtaatcaagcccatttctctttctctgggcttcacaataagacc
tttactgaccgtgaagtgttgttcgaaatgccgtttctatacgagcacgaagccaacgtg
attggtgatggttttcaaatgttggcgcaaacgtcaggaacgatcacgcatcctattgaa
ataggtcgctgccccgacaacattcccccataccgtgtgtactcgcaacatgcacctaag
cgttactacaactatctagtgattgaggattctgctggttacaccttgtttggcttcacg
acgtgccgtcgatttgctggttactttgatatacaacagcgaaatgggcagtggatactg
accgcagcaattgatggtgaacacacgcaagtggcggattgggaacacaatcaacttgag
tccattacgattttaactggcaactcgctatccgatctgtatcaagagttcagcgagatg
attgccgtgcatcatcctattcgcaacggtgttacgcaggatgcaccgataggctggtgt
tcttggtatgcgtactatgccgatgtgaccgagcaaaatgttttagaaaatgttgattgc
atgcaagacaagctcgaagacctagaatgggtacttctggatgatggctatcaagcgttc
atgggggattggcttacgccgtcggataaattctctggcggtgtgaaggagttgattcaa
aacattcgcgcaaaaggcaaaaagcctgcgatttggatggctcctttcatagcgcagcca
gaatctgaggtctttaagcaacatcctgaatggtttgttcgtcatcctgacggtcagctc
cttaaagctgaagatgttacctacggtggctggcgttgcacgccttggtatattctcgat
acgtctaaccccgaagtgcaagatcatctaacgcacgtggtgtcagtgatgaggctagag
tggggcgtagagctgtttaagctcgatgcaaactactggggaacactaaaaggaaaacgt
agtcagtctggtattacgggtgttgaagcgtatcgattagggatggaggcgatcgccaga
ggcgcaggagacgcgtggttgcttggctgcaacgcgccaatgtggccatctttggggctg
gtggatgcgatgcgtgtgtctgatgacgtcgagcgccatagccaccgttttgaacagatc
gctaaagagacgtttttccgtagctggcagcaccgtaaattgtggcaaattgacccagac
tgcgcgacgtttacttctcttgctaatcaagctgcatcacgtgaagactacgagtttcac
cgtaccgtattattggcgtctggcggcttgcttttgtctggcgaccctctcccggaaatc
acgccatttgcgagtaaaacgttggcgaagctgatgttgcgacaacgacgcagccaagaa
tctgctaagttcacggcgttaagtttgagccatgcttttttgaaactgacggacaagaat
gatctacattgtttgttcaattacgcgaatcacaatgcgactgaatttactctcacagcg
gatcagcccgttgattggtatgactactggaccggagaaaagctcaaccaagatccttgt
cagttgcttctagtgagtgtcgatagaggtctgaatgccaaagcaatagtgaccgcgtaa

DBGET integrated database retrieval system